Product: BDNF Antibody
Catalog: DF6387
Description: Rabbit polyclonal antibody to BDNF
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 15kD(mature), 28kDa(precursor), 45kD(unprocessed)(Observed); 28kD(Calculated).
Uniprot: P23560
RRID: AB_2838350

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
BDNF Antibody detects endogenous levels of total BDNF.
RRID:
AB_2838350
Cite Format: Affinity Biosciences Cat# DF6387, RRID:AB_2838350.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Abrineurin; ANON2; BDNF; BDNF_HUMAN; Brain Derived Neurotrophic Factor; Brain-derived neurotrophic factor; BULN2; MGC34632; Neurotrophin;

Immunogens

Immunogen:

A synthesized peptide derived from human BDNF, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P23560 BDNF_HUMAN:

Detected in blood plasma and in saliva (at protein level) (PubMed:11152678, PubMed:19467646). Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.

Description:
Neurotrophins function to regulate naturally occurring cell death of neurons during development. The prototype neurotrophin is nerve growth factor (NGF), originally discovered in the 1950s as a soluble peptide promoting the survival of, and neurite outgrowth from, sympathetic ganglia. Three additional structurally homologous neurotrophic factors have been identified. These include brain-derived neurotrophic factor (BDNF), neurotrophin-3 (NT-3) and neurotrophin-4 (NT-4) (also designated NT-5). These various neurotrophins stimulate the in vitro survival of distinct, but partially overlapping, populations of neurons. The cell surface receptors through which neurotrophins mediate their activity have been identified. For instance, the Trk A receptor is the preferential receptor for NGF, but also binds NT-3 and NT-4. The Trk B receptor binds both BDNF and NT-4 equally well, and binds NT-3 to a lesser extent, while the Trk C receptor only binds NT-3.
Sequence:
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
100
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Important signaling molecule that activates signaling cascades downstream of NTRK2. During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.

Important signaling molecule that activates signaling cascades downstream of NTRK2. Activates signaling cascades via the heterodimeric receptor formed by NGFR and SORCS2. Signaling via NGFR and SORCS2 plays a role in synaptic plasticity and long-term depression (LTD). Binding to NGFR and SORCS2 promotes neuronal apoptosis. Promotes neuronal growth cone collapse (By similarity).

PTMs:

N-glycosylated and glycosulfated, contrary to mature BDNF.

Mature BDNF is produced by proteolytic removal of the propeptide, catalyzed by a FURIN family member. In addition, the precursor form is proteolytically cleaved within the propeptide, but this is not an obligatory intermediate for the production of mature BDNF. Can be converted into mature BDNF by plasmin (PLG).

Subcellular Location:

Secreted.

Secreted.
Note: A proportion of BDNF is secreted as immature precursor (proBDNF).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in blood plasma and in saliva (at protein level). Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.

Family&Domains:

Belongs to the NGF-beta family.

Research Fields

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Human Diseases > Substance dependence > Cocaine addiction.

· Human Diseases > Substance dependence > Alcoholism.

· Organismal Systems > Nervous system > Neurotrophin signaling pathway.   (View pathway)

References

1). Haploinsufficiency of intraflagellar transport protein 172 causes autism-like behavioral phenotypes in mice through BDNF. Journal of advanced research, 2024 (PubMed: 39265888) [IF=11.4]

Application: WB    Species: Mouse    Sample:

Fig. 4. Ift172 haploinsufficiency led to a dysfunctional BDNF-TrkB signaling pathway and reduced synaptic density. (A) Compared with WT littermates, Ift172+/- mice showed reduced expression of BDNF, p-TrkB, p-Erk1/2, and PSD95 in the cortex. (B) Quantification of relative protein expressing levels (n = 3 per group). (C) Immunohistochemical staining showed decreased BDNF expression in the brain of Ift172+/- mice compared with WT littermates. Scale bars = 2 mm (left column) and 10 μm (right column). (D) Immunofluorescent staining of Ift172 and BDNF in the cortex of WT and Ift172+/- mice. Scale bar = 20 µm. (E) Quantification analysis of the expression of Ift172 and BDNF proteins (n = 5 per group). (F) Schematic diagram showed the construct of an adeno-associated virus and the strategy of sparse labeling. (G) Confocal images of representative pyramidal neurons and their apical dendrites in the CA1 region of WT and Ift172+/- mice. Scale bars = 10 μm (top row) and 5 μm (bottom row). (H) Compared with WT littermates, Ift172+/- mice presented significantly less spine density. (WT: n = 11 dendrites from 3 mice; Ift172+/-: n = 15 dendrites from 3 mice). (I) Representative electron micrographs of the synaptic structures in the CA1 area. Red arrows indicated synapses. Scale bar = 1 μm. (J) Quantitative analysis of the synaptic density in WT and Ift172+/- mice. (n = 5 per group). Data were presented as the mean ± s.e.m. (*p < 0.05, **p < 0.01, and ***p < 0.001 with Student’s t-test). (For interpretation of the references to colour in this figure legend, the reader is referred to the web version of this article.)

2). Dysregulation of CRY1 impairs brain thyroid hormone pathway and promotes anxiety-like behavior in male mice. Metabolism: clinical and experimental, 2025 (PubMed: 40334908) [IF=10.8]

3). G-protein coupled receptor kinase 2 mediates rheumatoid arthritis-induced depression-like behaviors via the hippocampal CRHR1 signaling pathway. Acta pharmacologica Sinica, 2025 (PubMed: 40691271) [IF=6.9]

4). Comparative assessment of various protein isolates underpinning cognitive modulation: An interplay of neurobiological markers and gut-brain axis. Current research in food science, 2025 (PubMed: 41234364) [IF=6.3]

5). MANF Promotes Diabetic Corneal Epithelial Wound Healing and Nerve Regeneration by Attenuating Hyperglycemia-Induced Endoplasmic Reticulum Stress. DIABETES, 2020 (PubMed: 32312869) [IF=6.2]

Application: WB    Species: mice    Sample: corneal epithelial cells

Figure 3—Exogenous MANF promoted corneal nerve regeneration and BDNF and NGF expression. Normal and diabetic corneas pretreated through subconjunctival injection with PBS (as the control) or rhMANF 24 h before, 0 h, and 24 h after removal of the corneal epithelium. At 48 h, corneal epithelial cells were collected for Western blotting. At 5 days postwounding, corneal whole-mount staining was performed to observe nerve regeneration. Corneal sensation was tested before epithelium debridement until 7 days postwounding. To observe nerve regeneration and corneal sensation, another injection was performed at 48 h postwounding. A: Staining for b-tubulin III was performed, and images of the entire cornea were captured as shown in the top panels, with central cornea images shown in the bottom panels. B: Nerve densities of entire corneas (A, top panels) were calculated from the areas staining positive for b-tubulin III using Image J software (n 5 3). C: Corneal sensation is represented with a line chart (n 5 5). The time immediately before epithelium debridement was defined as 0 h. D: Western blot bands observed with or without rhMANF. Two samples/lane represent each condition, three corneas as one sample. E: Western blot analysis of BDNF expression (n 5 4 samples). F: Western blot analysis of NGF expression (n 5 4 samples). *P , 0.05, **P , 0.01, ***P , 0.001 (one-way ANOVA). DM, wounded mice with diabetes mellitus; DM 1 MANF, wounded mice with diabetes mellitus treated with rhMANF; NL, wounded normoglycemic mice treated with PBS; NL 1 MANF, wounded normoglycemic mice treated with rhMANF; n.s., not significant.

6). Acetyl-11-keto-beta-boswellic acid promotes sciatic nerve repair after injury: molecular mechanism. Neural Regeneration Research, 2022 (PubMed: 35662229) [IF=5.9]

Application: WB    Species: Rat    Sample:

Figure 3 Gene and protein verification in sciatic nerve injury in rats treated with AKBA. (A) mRNA expression levels (relative to GAPDH) of NGFR (A1), NGF (A2), BDNF (A3), and MPO (A4) in the rat sciatic nerve using qPCR. (B) Protein expression levels (relative to GAPDH) of NGFR (B2), NGF (B3), BDNF (B4), and MPO (B5) in the rat sciatic nerve by western blot assay. Data are expressed as the mean ± SD (n = 3 rats/group) and were analyzed using a one-way analysis of variance followed by the least significant difference test. BDNF: Brain derived neurotrophic factor; GAPDH: glyceraldehyde-3-phosphate dehydrogenase; MPO: myeloperoxidase; NGF: nerve growth factor; NGFR: nerve growth factor receptor; qPCR: real-time polymerase chain reaction.

7). Antidepressant-like Effect of Citrus sinensis (L.) Osbeck Essential Oil and Its Main Component Limonene on Mice. Journal of Agricultural and Food Chemistry, 2019 (PubMed: 30905156) [IF=5.7]

8). Zhile Capsule Exerts Antidepressant-Like Effects through Upregulation of the BDNF Signaling Pathway and Neuroprotection. International Journal of Molecular Sciences, 2019 (PubMed: 30625977) [IF=5.6]

Application: WB    Species: rat    Sample: hippocampus

Figure 6.| ZL activated cAMP-CREB-BDNF signaling. (A–C) Protein expressions of BDNF, p-CREB and CREB in the hippocampus at the end of experiment determined by western blotting.Quantified protein level was normalized to that of GAPDH using densitometry (n = 3)

9). Lactate supplementation after hypoglycemia alleviates cognitive dysfunction induced by recurrent non-severe hypoglycemia in diabetic mice. Experimental neurology, 2025 (PubMed: 39481512) [IF=5.3]

10). Effects of Lifelong Exercise on Age-Related Body Composition, Oxidative Stress, Inflammatory Cytokines, and Skeletal Muscle Proteome in Rats. MECHANISMS OF AGEING AND DEVELOPMENT, 2020 (PubMed: 32422206) [IF=5.3]

Application: WB    Species: rat    Sample: gastrocnemius muscles

Fig. 6. |Expression of AKT/FOXO1 signaling pathway (A); mitochondrial function markers(B); BDNF signaling-related proteins (C); and representative confocal microscopy images of BDNF staining (green, magnification: ×40,scale Bar 50 μm) (D: a, 8 M–SED; b, 26 M–SED;c, 18 M–MICT; d, 8 M–MICT); and serum BDNF levels (E); and correlation analysis (F).

Application: IF/ICC    Species: rat    Sample: gastrocnemius muscles

Fig. 6. |Expression of AKT/FOXO1 signaling pathway (A); mitochondrial function markers(B); BDNF signaling-related proteins (C); and representative confocal microscopy images of BDNF staining (green, magnification: ×40,scale Bar 50 μm) (D: a, 8 M–SED; b, 26 M–SED;c, 18 M–MICT; d, 8 M–MICT); and serum BDNF levels (E); and correlation analysis (F).

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.