CDK6 Antibody - #DF6448

(6)   (3)  
Product: CDK6 Antibody
Catalog: DF6448
Description: Rabbit polyclonal antibody to CDK6
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Chicken
Mol.Wt.: 36kDa; 37kD(Calculated).
Uniprot: Q00534
RRID: AB_2838411

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(88%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%), Chicken(100%)
Clonality:
Polyclonal
Specificity:
CDK6 Antibody detects endogenous levels of total CDK6.
RRID:
AB_2838411
Cite Format: Affinity Biosciences Cat# DF6448, RRID:AB_2838411.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CDK 6; CDK6; CDK6_HUMAN; Cell division protein kinase 6; Crk 2; Crk2; Cyclin dependent kinase 6; Cyclin-dependent kinase 6; MCPH12; MGC59692; p40; PLSTIRE; Serine/threonine protein kinase PLSTIRE; Serine/threonine-protein kinase PLSTIRE; STQTL11;

Immunogens

Immunogen:
Uniprot:

Q00534(CDK6_HUMAN) >>Visit HPA database.

Gene(ID):
CDK6(1021)
Expression:
Q00534 CDK6_HUMAN:

Expressed ubiquitously. Accumulates in squamous cell carcinomas, proliferating hematopoietic progenitor cells, beta-cells of pancreatic islets of Langerhans, and neuroblastomas. Reduced levels in differentiating cells.

Description:
The cyclin-dependent kinases form complexes with their cyclin partners and with CDK inhibitors. CDK6 and CDK4 associate with the D-type cyclins and target the retinoblastoma protein, allowing passage through the G1/S phase restriction point (1). CDK6/cyclin D complexes are sequestered in their inactive form through binding to one of the INK4 CDK inhibitor family members (2,3). Unlike the INK4 family of cdk inhibitors, the CDK inhibitor p21 Waf1/Cip1 may enhance the association of CDK4 and CDK6 with their cyclin D partners (4).
Sequence:
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Chicken
100
Rabbit
100
Zebrafish
88
Xenopus
75
Sheep
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q00534 As Substrate

Site PTM Type Enzyme
M1 Acetylation
K3 Acetylation
K3 Methylation
K3 Ubiquitination
Y13 Phosphorylation
Y24 Phosphorylation
K26 Acetylation
K26 Ubiquitination
K29 Ubiquitination
K34 Ubiquitination
K43 Acetylation
K43 Ubiquitination
T49 Phosphorylation
S57 Phosphorylation
T70 Phosphorylation
S86 Phosphorylation
K93 Ubiquitination
K111 Ubiquitination
K123 Ubiquitination
K147 Ubiquitination
S155 Phosphorylation
K160 Ubiquitination
T177 Phosphorylation P50613 (CDK7)
S222 Phosphorylation
S223 Phosphorylation
K230 Ubiquitination
K257 Ubiquitination
K264 Acetylation
K264 Ubiquitination
T267 Phosphorylation
K274 Ubiquitination
K279 Ubiquitination
K287 Ubiquitination
S290 Phosphorylation
Y292 Phosphorylation
S293 Phosphorylation
S296 Phosphorylation
Y299 Phosphorylation
K307 Ubiquitination
S317 Phosphorylation
T325 Phosphorylation

PTMs - Q00534 As Enzyme

Substrate Site Source
P06400 (RB1) S612 Uniprot
P06400 (RB1) S780 Uniprot
P06400 (RB1) S788 Uniprot
P06400 (RB1) S795 Uniprot
P06400 (RB1) S807 Uniprot
P06400 (RB1) S811 Uniprot
P06400 (RB1) T821 Uniprot
P06400 (RB1) T826 Uniprot
P06748 (NPM1) T199 Uniprot
P10415 (BCL2) S70 Uniprot
P10415 (BCL2) S87 Uniprot
P35222 (CTNNB1) S45 Uniprot
P38936 (CDKN1A) S130 Uniprot
P46527 (CDKN1B) S10 Uniprot
P46527 (CDKN1B) T187 Uniprot
Q01196 (RUNX1) S21 Uniprot
Q01196 (RUNX1) S249 Uniprot
Q01196 (RUNX1) S266 Uniprot
Q01196 (RUNX1) T273 Uniprot
Q01196 (RUNX1) S276 Uniprot
Q01196-8 (RUNX1) S293 Uniprot
Q01196-8 (RUNX1) T300 Uniprot
Q01196-8 (RUNX1) S303 Uniprot
Q01196 (RUNX1) S397 Uniprot
Q04206 (RELA) S536 Uniprot
Q05682 (CALD1) T730 Uniprot
Q05682 (CALD1) S789 Uniprot
Q06830 (PRDX1) T90 Uniprot
Q08050 (FOXM1) S4 Uniprot
Q08050 (FOXM1) S35 Uniprot
Q08050 (FOXM1) S451 Uniprot
Q08050 (FOXM1) S489 Uniprot
Q08050 (FOXM1) S508 Uniprot
Q08050 (FOXM1) T510 Uniprot
Q08050 (FOXM1) S522 Uniprot
Q08050 (FOXM1) T600 Uniprot
Q08050 (FOXM1) T611 Uniprot
Q08050 (FOXM1) T620 Uniprot
Q08050 (FOXM1) T627 Uniprot
Q08050 (FOXM1) S704 Uniprot
Q08999 (RBL2) T401 Uniprot
Q08999 (RBL2) S672 Uniprot
Q08999 (RBL2) S1035 Uniprot
Q92879 (CELF1) S302 Uniprot
Q96KS0 (EGLN2) S130 Uniprot

Research Backgrounds

Function:

Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation; promotes G1/S transition. Phosphorylates pRB/RB1 and NPM1. Interacts with D-type G1 cyclins during interphase at G1 to form a pRB/RB1 kinase and controls the entrance into the cell cycle. Involved in initiation and maintenance of cell cycle exit during cell differentiation; prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types (e.g. erythroid and hematopoietic cells). Essential for cell proliferation within the dentate gyrus of the hippocampus and the subventricular zone of the lateral ventricles. Required during thymocyte development. Promotes the production of newborn neurons, probably by modulating G1 length. Promotes, at least in astrocytes, changes in patterns of gene expression, changes in the actin cytoskeleton including loss of stress fibers, and enhanced motility during cell differentiation. Prevents myeloid differentiation by interfering with RUNX1 and reducing its transcription transactivation activity, but promotes proliferation of normal myeloid progenitors. Delays senescence. Promotes the proliferation of beta-cells in pancreatic islets of Langerhans. May play a role in the centrosome organization during the cell cycle phases.

PTMs:

Thr-177 phosphorylation and Tyr-24 dephosphorylation promotes kinase activity.

Subcellular Location:

Cytoplasm. Nucleus. Cell projection>Ruffle. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome.
Note: Localized to the ruffling edge of spreading fibroblasts. Kinase activity only in nucleus. Localized to the cytosol of neurons and showed prominent staining around either side of the nucleus (By similarity). Present in the cytosol and in the nucleus in interphase cells and at the centrosome during mitosis from prophase to telophase (PubMed:23918663).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed ubiquitously. Accumulates in squamous cell carcinomas, proliferating hematopoietic progenitor cells, beta-cells of pancreatic islets of Langerhans, and neuroblastomas. Reduced levels in differentiating cells.

Subunit Structure:

Interaction with D-type G1 cyclins. Cyclin binding promotes enzyme activation by phosphorylation at Thr-177 (By similarity). Binds to RUNX1, CDKN2D, FBXO7 and CDKN2C/p18-INK4c. Forms a cytoplasmic complex with Hsp90/HSP90AB1 and CDC37. FBXO7-binding promotes D-type cyclin binding. Interacts with Kaposi's sarcoma herpesvirus (KSHV) V-cyclin and herpesvirus saimiri (V-cyclin/ECLF2); the CDK6/V-cyclin complex phosphorylates NPM1 and thus lead to viral reactivation by reducing viral LANA levels.

Family&Domains:

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Measles.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Pancreatic cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.   (View pathway)

· Human Diseases > Cancers: Specific types > Small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

References

1). d-Borneol enhances cisplatin sensitivity via p21/p27-mediated S-phase arrest and cell apoptosis in non-small cell lung cancer cells and a murine xenograft model. Cellular & Molecular Biology Letters (PubMed: 35883026) [IF=8.3]
2). CircRNA circ_0072995 promotes the progression of epithelial ovarian cancer by modulating miR-147a/CDK6 axis. Aging-US (PubMed: 32877369) [IF=5.2]

Application: WB    Species: Human    Sample: HO8910 and A2780 cells

Figure 5 CDK6 was directly targeted by miR-147a and was indirectly regulated by circ_0072995. (A) The target genes of miR-147a were predicted in databases (TargetScan, miRWalk, miRDB, StarBase) and there were 141 genes which overlapped in the Venn diagram. (B) PPI network analyses was performed by use of the String database, and results with a combined score of > 0.4 were selected. Among these, CDK6, AKT3, AKT2, PDPK1 were found to have had a high degree of connectivity and were selected as hub genes for miR-147a. (C) CDK6, AKT3, AKT2 expression was significantly reduced after overexpression of miR-147a, especially for CDK6. (D) There were multiple binding sites between miR-147a and CDK6. (E) The binding relationship between miR-147a and CDK6 was confirmed by dual-luciferase reporter assays. (F) miR-147a mimics markedly reduced expression of CDK6, whereas miR-147a inhibitors significantly enhanced CDK6 levels in HO8910 and A2780 cells. (G) Expression of CDK6 mRNA decreased after knockdown of circ_0072995, but was rescued by miR-147a inhibitors as determined by qRT-PCR. (H) The expression of CDK6 proteins decreased after knockdown of circ_0072995, but was rescued by miR-147a inhibitors as determined by WB.
3). HMGB2 promotes chondrocyte proliferation under negative pressure through the phosphorylation of AKT. BIOCHIMICA ET BIOPHYSICA ACTA-MOLECULAR CELL RESEARCH (PubMed: 34333060) [IF=5.1]
4). miR-3619-5p inhibits prostate cancer cell growth by activating CDKN1A expression. ONCOLOGY REPORTS (PubMed: 27878260) [IF=4.2]

Application: WB    Species: human    Sample:

(D) Expression of cyclin D1, CDK4 and CDK6 mRNA was determined by western blot analysis. α-Tublin served as a loading control. *
5). Overexpression of p53 activated by small activating RNA suppresses the growth of human prostate cancer cells. OncoTargets and Therapy (PubMed: 26811691) [IF=4.0]

Application: WB    Species: human    Sample: human

Figure 2 dsP53-285 suppresses Cyclin D1–CDK4/6 expression in PCa cell lines. Notes: LNCaP and DU145 cells were transfected with the indicated dsRNAs at 50 nM for 72 hours or mock transfected for 72 hours. (A) Expression of Cyclin D1 and CDK4/6 in both PCa cell lines was assessed by real-time PCR. GAPDH served as a loading control. *P,0.05 and **P,0.01 compared with the mock group; #P,0.05 and ##P,0.01 compared with the dsControl group. (B) Expression of Cyclin D1 and CDK4/6 protein was determined by Western blotting. α-Tubulin served as a loading control. Abbreviations: CDK, cyclin-dependent kinase; PCa, prostate cancer; dsRNA, double-stranded RNA; PCR, polymerase chain reaction; GAPDH, glyceraldehyde 3-phosphate dehydrogenase.
6). A New Double Stranded RNA Suppresses Bladder Cancer Development by Upregulating p21Waf1/CIP1 Expression. Biomed Research International (PubMed: 25918708)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.