| Product: | Caspase 6 Antibody |
| Catalog: | DF6616 |
| Description: | Rabbit polyclonal antibody to Caspase 6 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 22kDa(Observed); 33kD(Calculated). |
| Uniprot: | P55212 |
| RRID: | AB_2838578 |
Control Products
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6616, RRID:AB_2838578.
Fold/Unfold
Apoptotic protease Mch-2; Apoptotic protease MCH2; CASP-6; CASP6; CASP6_HUMAN; Caspase 6; Caspase 6 apoptosis related cysteine protease; Caspase 6, apoptosis related cysteine peptidase; Caspase-6 subunit p11; Mch2; OTTHUMP00000162742; OTTHUMP00000162743;
Immunogens
A synthesized peptide derived from human Caspase 6, corresponding to a region within the internal amino acids.
- P55212 CASP6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Research Backgrounds
Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves poly(ADP-ribose) polymerase in vitro, as well as lamins. Overexpression promotes programmed cell death.
Cleavages by caspase-3, caspase-8 or -10 generate the two active subunits.
Cytoplasm.
Belongs to the peptidase C14A family.
Research Fields
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.