Product: EIF5A1 Antibody
Catalog: DF6754
Description: Rabbit polyclonal antibody to EIF5A1
Application: WB IHC IF/ICC
Cited expt.: IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 16kDa(Observed); 17kD(Calculated).
Uniprot: P63241
RRID: AB_2838716

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Zebrafish(%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%)
Clonality:
Polyclonal
Specificity:
EIF5A Antibody detects endogenous levels of total EIF5A1.
RRID:
AB_2838716
Cite Format: Affinity Biosciences Cat# DF6754, RRID:AB_2838716.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

eIF 4D; eIF 5A 1; EIF 5A; eIF 5A1; eIF-4D; eIF-5A; eIF-5A-1; eIF-5A1; eIF4D; eif5a; EIF5A1; eIF5AI; Eukaryotic initiation factor 5A; Eukaryotic initiation factor 5A isoform 1; Eukaryotic translation initiation factor 5A 1; Eukaryotic translation initiation factor 5A; Eukaryotic translation initiation factor 5A-1; IF5A1_HUMAN; MGC104255; MGC99547; Rev binding factor; Rev-binding factor; uORF A; uORF;

Immunogens

Immunogen:

A synthesized peptide derived from human EIF5A1 corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P63241 IF5A1_HUMAN:

Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level).

Description:
mRNA-binding protein involved in translation elongation. Has an important function at the level of Mrna turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts.
Sequence:
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Zebrafish
80
Chicken
80
Xenopus
70
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts.

PTMs:

Acetylated. Deacetylated by SIRT2.

eIF-5A seems to be the only eukaryotic protein to have a hypusine residue which is a post-translational modification of a lysine by the addition of a butylamino group (from spermidine).

Subcellular Location:

Cytoplasm. Nucleus. Endoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side. Nucleus>Nuclear pore complex.
Note: Hypusine modification promotes the nuclear export and cytoplasmic localization and there was a dynamic shift in the localization from predominantly cytoplasmic to primarily nuclear under apoptotic inducing conditions.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level).

Family&Domains:

Belongs to the eIF-5A family.

References

1). Comparison of the major cell populations among osteoarthritis, Kashin–Beck disease and healthy chondrocytes by single-cell RNA-seq analysis. Cell Death & Disease, 2021 (PubMed: 34045450) [IF=8.1]

Application: IHC    Species: Human    Sample: healthy cartilage tissues

Fig. 1 Single-cell RNA-sequencing analysis of human healthy control chondrocyte tissue samples. A Seven healthy human chondrocyte clusters. Visualisation of clustering by t-SNE plot of healthy control samples, identified by cell type. B Monocle pseudotime trajectory showing the progression of seven clusters of healthy chondrocytes. C Heat map of scaled gene expression data for the top 10 differentially expressed genes identifying each cluster, with selected genes listed. D Gene expression plots demonstrating high expression of SH3BGRL3 in SH3BGRL3hi fibrocartilage chondrocytes-1, IGFBP5 in IGFBP5hi fibrocartilage chondrocytes-2, CDC20 in CDC20hi cartilage progenitor cells-1, KIAA0101 in KIAA0101hi cartilage progenitor cells-2, EIF5A in EIF5Ahi regulatory chondrocytes, SOX9 in SOX9hi prehypertrophic chondrocytes and TXNIP in TXNIPhi homeostatic chondrocytes. Dot colour corresponds to the level of gene expression in each cell. t-SNE, t-distributed stochastic neighbour embedding. E Representative immunohistochemistry staining of SH3BGRL3, IGFBP5, BIRC5, SOX9, EIF5A and CDC20 in healthy cartilage tissues. Scale bar, left, 500 μm; right, 50 μm, and quantification of positive cells of different areas (superficial, middle, deep) in cartilage tissues displayed by box plot (n = 5). *p < 0.05.

Application: IHC    Species: human    Sample: cartilage

Fig. 1 |Single-cell RNA-sequencing analysis of human healthy control chondrocyte tissue samples.E Representative immunohistochemistry staining of SH3BGRL3, IGFBP5, BIRC5, SOX9, EIF5A and CDC20 in healthy cartilage tissues. Scale bar, left, 500 μm; right, 50 μm, and quantification of positive cells of different areas (superficial, middle, deep) in cartilage tissues displayed by box plot (n = 5). *p < 0.05.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.