Product: IL10 Antibody
Catalog: DF6894
Source: Rabbit
Application: WB, IHC, IF/ICC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 19kD; 21kD(Calculated).
Uniprot: P22301
RRID: AB_2838853

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Prediction:
Pig(83%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(89%), Dog(100%), Xenopus(89%)
Clonality:
Polyclonal
Specificity:
IL10 Antibody detects endogenous levels of total IL10.
RRID:
AB_2838853
Cite Format: Affinity Biosciences Cat# DF6894, RRID:AB_2838853.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CSIF; Cytokine synthesis inhibitory factor; GVHDS; IL 10; IL-10; IL10; IL10_HUMAN; IL10A; Interleukin 10; Interleukin-10; MGC126450; MGC126451; T-cell growth inhibitory factor; TGIF;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P22301 IL10_HUMAN:

Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.

Description:
IL-10 is an anti-inflammatory cytokine that is produced by T cells, NK cells and macrophages (1,2). IL-10 initiates signal transduction by binding to a cell surface receptor complex consisting of IL-10 RI and IL-10 RII (1). Binding of IL-10 leads to the activation of Jak1 and Tyk2, which phosphorylates Stat-3 (1,3). The anti-inflammatory activity of IL-10 is due to its ability to block signaling through other cytokine receptors, notably IFNγ receptor, by upregulating expression of SOCS-1 (1,3). In addition, IL-10 promotes T cell tolerance by inhibiting tyrosine phosphorylation of CD28 (4,5). IL-10 is an important negative regulator of the immune response, which allows for maintenance of pregnancy (1). In contrast, increased IL-10 levels contribute to persistent Leishmania major infections (6).
Sequence:
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
89
Rabbit
89
Pig
83
Chicken
75
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha. Interferes also with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation. In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling (By similarity).

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.

Subunit Structure:

Homodimer. Interacts with IL10RA and IL10RB.

Family&Domains:

Belongs to the IL-10 family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.

· Human Diseases > Infectious diseases: Parasitic > Malaria.

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.

· Human Diseases > Infectious diseases: Bacterial > Staphylococcus aureus infection.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Immune diseases > Asthma.

· Human Diseases > Immune diseases > Autoimmune thyroid disease.

· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).

· Human Diseases > Immune diseases > Systemic lupus erythematosus.

· Human Diseases > Immune diseases > Allograft rejection.

· Organismal Systems > Immune system > T cell receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Intestinal immune network for IgA production.   (View pathway)

References

1). Chen XJ et al. A novel lymphatic pattern promotes metastasis of cervical cancer in a hypoxic tumour-associated macrophage-dependent manner. Angiogenesis 2021 Aug;24(3):549-565. (PubMed: 33484377) [IF=10.658]

2). Ding T et al. An in situ tissue engineering scaffold with growth factors combining angiogenesis and osteoimmunomodulatory functions for advanced periodontal bone regeneration. J Nanobiotechnology 2021 Aug 17;19(1):247. (PubMed: 34404409) [IF=10.435]

3). Yan S et al. Mesenchymal Stem Cells Overexpressing ACE2 Favorably Ameliorate LPS-Induced Inflammatory Injury in Mammary Epithelial Cells. Front Immunol 2022 Jan 14;12:796744. (PubMed: 35095873) [IF=8.786]

4). Tao HC et al. CD47 Deficiency in Mice Exacerbates Chronic Fatty Diet-Induced Steatohepatitis Through Its Role in Regulating Hepatic Inflammation and Lipid Metabolism. Front Immunol 2020 Feb 25;11:148 (PubMed: 32158445) [IF=8.786]

Application: IHC    Species: mouse    Sample: Liver

Figure S2. |Liver sections were IHC stained for TGF-β (a), IL-6 (b) and IL-10 (c). Three samples per group were examined, and representative images are shown (Scale bar represents 50 µm).

5). Hu J et al. Effects of Xin-Ji-Er-Kang on heart failure induced by myocardial infarction: Role of inflammation, oxidative stress and endothelial dysfunction. Phytomedicine 2018 Mar 15;42:245-257 (PubMed: 29655692) [IF=6.656]

Application: WB    Species: mouse    Sample: serum and cardiac

Fig. 10: |Effects of XJEK on protein expression in MI mice with WB method(A-C) Representative figures of TNF-α, IL-1β and IL-10 protein. (D-F) Quantitative analyses of TNF-α, IL-1β and IL-10 protein. (mean ± S.D, n = 3).

6). Tan H et al. The Programmed Cell Death Ligand-1/Programmed Cell Death-1 Pathway Mediates Pregnancy-Induced Analgesia via Regulating Spinal Inflammatory Cytokines. Anesth Analg 2021 Sep 14;133(5):1321-1330. (PubMed: 34524124) [IF=6.627]

Application: WB    Species: Mouse    Sample: RAW264.7 cells

Figure 5. ARR downregulates the protein expression of TRAF6 and NF-κB p65 by increasing the content of NLRC3 protein molecules. (A) Expression levels of NLRC3, TRAF6 and NF-κB p65 in LPS-stimulated RAW264.7 cells were detected using immunohistochemistry staining (magnification, ×400; scale bar, 200-µm). The mean optical density values of (B) NLRC3, (C) TRAF6 and (D) NF-κB p65 were quantified using ImageJ software. The protein expression levels of (E) NLRC3 and (F) TRAF6 were detected using western blotting and semi-quantified using Image Lab software. LPS represents protein from the 100 ng/ml LPS-treated group; Indo represents protein from the 8 µg/ml Indo and 100 ng/ml LPS-treated group; ARR represents protein from the 100 µg/ml ARR and 100 ng/ml LPS-treated group. Data are presented as the mean ± SD (n=3). ##P<0.01 vs. control group; *P<0.05, **P<0.01 vs. LPS group. ARR, α-rhamnrtin-3-α-rhamnoside; TRAF6, tumor necrosis factor-associated factor 6; NLRC3, NOD-like receptor family CARD domain containing 3; LPS, lipopolysaccharide; Indo, indomethacin.

7). Zhang C et al. FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice. Aging (Albany NY) 2020 Jan 20;12(2):1272-1284 (PubMed: 31959736) [IF=5.955]

Application: WB    Species: mouse    Sample: testicular

Figure 7. |FOXO4-DRI improves the testicular microenvironment in naturally aged mice.(F–L) Western blots revealing that FOXO4-DRI decreases levels of the SASP factors IL-1β, IL-6 and TGF-β in testes of aged mice, but has no effect on testicular levels of IL-1α, IL-10 and TNF-α. Data depict the mean ± SD. n=6. *P<0.05. NS, nonsignificant.

8). Zhou Y et al. Bmal1 Regulates Macrophage Polarize Through Glycolytic Pathway in Alcoholic Liver Disease. Front Pharmacol 2021 Mar 10;12:640521. (PubMed: 33790796) [IF=5.810]

Application: WB    Species: Mice    Sample: liver tissue

FIGURE 2 Phenotypic characteristics of macrophages in EtOH-fed mice liver tissue and ethanol-stimulated RAW264.7 cells. (A) Effects of ethanol on protein and mRNA levels of M1 macrophage markers (TNF-α, IL-1β) in liver tissue. (B) The protein and mRNA levels of M2 macrophage markers (IL-10, ARG-1) in liver tissue. (C) Immunofluorescence staining results of M1, M2 macrophage markers (CD86, CD206) in liver tissue of EtOH-fed mice. (D) The protein and mRNA levels of M1 macrophage (TNF-α, IL-1β) in ethanol-induced RAW264.7 cells. (E) The protein and mRNA levels of M2 macrophage markers (IL-10, ARG-1) in ethanol-induced RAW264.7 cells. The results are shown as relative expression against control expression without treatment. Data shown are the mean ± SD from three independent experiments. *p < 0.05, **p < 0.01 vs. CD-fed group or control group.

9). Yan S et al. Wu-Mei-Wan Ameliorates Murine Ulcerative Colitis by Regulating Macrophage Polarization. Front Pharmacol 2022 Mar 21;13:859167. (PubMed: 35387334) [IF=5.810]

10). Zhao T et al. Folic acid attenuates glial activation in neonatal mice and improves adult mood disorders through epigenetic regulation. Front Pharmacol 2022 Feb 7;13:818423. (PubMed: 35197855) [IF=5.810]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.