Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    PSMA1 Antibody
  • Catalog No.
    DF6984
  • RRID
    AB_2838940
  • Source
    Rabbit
  • Application
    WB,IHC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Bovine, Horse, Sheep, Rabbit, Chicken
  • UniProt
  • Mol.Wt
    29kD;
    30kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

30 kDa prosomal protein; HC 2; HC2; Macropain subunit C2; Macropain subunit nu; MGC14542; MGC14575; MGC14751; MGC1667; MGC21459; MGC22853; MGC23915; Multicatalytic endopeptidase complex subunit C2; NU; PROS 30; PROS-30; PROS30; Proteasome (prosome macropain) subunit alpha type 1; Proteasome alpha 1 subunit; Proteasome component C2; Proteasome nu chain; Proteasome subunit alpha type 1; Proteasome subunit alpha type I; Proteasome subunit alpha type-1; Proteasome subunit nu; Protein P30 33K; PSA1_HUMAN; PSC 2; PSC2; PSMA 1; psmA1;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Bovine, Horse, Sheep, Rabbit, Chicken

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

PSMA1 Antibody detects endogenous levels of total PSMA1.

RRID:

AB_2838940
Please cite this product as: Affinity Biosciences Cat# DF6984, RRID:AB_2838940.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human PSMA1, corresponding to a region within C-terminal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

PSMA1

Molecular Weight:

Observed Mol.Wt.: 29kD.
Predicted Mol.Wt.: 30kDa(Calculated)..

Subcellular Location:

Cytoplasm. Nucleus.

Description:

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Sequence:
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH

Research Background

Function:

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is a barrel-shaped complex made of 28 subunits that are arranged in four stacked rings. The two outer rings are each formed by seven alpha subunits, and the two inner rings are formed by seven beta subunits. The proteolytic activity is exerted by three beta-subunits PSMB5, PSMB6 and PSMB7. Interacts with NOTCH3. Interacts with ZFAND1.

Similarity:

Belongs to the peptidase T1A family.

Research Fields

Research Fields:

· Genetic Information Processing > Folding, sorting and degradation > Proteasome.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF6984-BP
(Blocking peptide available as DF6984-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Horse
100%
Bovine
100%
Sheep
100%
Rabbit
100%
Chicken
92%
Xenopus
67%
Pig
0%
Dog
0%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
P25786 as Substrate
Site PTM Type Enzyme
S14 Phosphorylation
K30 Ubiquitination
K39 Ubiquitination
S40 Phosphorylation
K41 Ubiquitination
T42 Phosphorylation
K50 Methylation
K50 Ubiquitination
S54 Phosphorylation
K61 Ubiquitination
S106 Phosphorylation
S110 Phosphorylation
S114 Phosphorylation
K115 Ubiquitination
T116 Phosphorylation
S150 Phosphorylation
Y153 Phosphorylation
S160 Phosphorylation
S177 Phosphorylation
C182 S-Nitrosylation
K189 Ubiquitination
K208 Ubiquitination
S211 Phosphorylation
S230 Phosphorylation
K243 Sumoylation
K243 Ubiquitination
K256 Ubiquitination
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top