Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    SUMO2 Antibody
  • Catalog No.
    DF7024
  • RRID
    AB_2838980
  • Source
    Rabbit
  • Application
    WB,IHC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus
  • UniProt
  • Mol.Wt
    11kD;
    11kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

HSMT3; MGC117191; OTTHUMP00000115275; OTTHUMP00000115276; OTTHUMP00000115277; Sentrin 2; Small ubiquitin like modifier 2; Small ubiquitin related modifier 2; small ubiquitin-like modifier 3; small ubiquitin-related modifier 3; SMT3 homolog 1; SMT3 homolog 2; SMT3 suppressor of mif two 3 homolog 1; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 3; SMT3A; SMT3B; SMT3H1; SMT3H2; Sumo2; Sumo3; Ubiquitin like protein SMT3A; Ubiquitin like protein SMT3B;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

SUMO2 Antibody detects endogenous levels of total SUMO2.

RRID:

AB_2838980
Please cite this product as: Affinity Biosciences Cat# DF7024, RRID:AB_2838980.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human SUMO2, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

SUMO2

Molecular Weight:

Observed Mol.Wt.: 11kD.
Predicted Mol.Wt.: 11kDa(Calculated)..

Subcellular Location:

Nucleus. Nuclear bodies.

Tissue Specificity:

P61956 SUMO2_HUMAN:
Broadly expressed.

Description:

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Sequence:
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Research Background

Function:

Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2, CBX4 or ZNF451. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Plays a role in the regulation of sumoylation status of SETX.

Post-translational Modifications:

Polymeric chains can be formed through Lys-11 cross-linking. Polymeric SUMO2 chains undergo 'Lys-6'-, 'Lys-11'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination by RNF4.

Cleavage of precursor form by SENP1 or SENP2 is necessary for function.

Monoubiquitinated N-terminally by UBE2W, which primes it for RNF4-dependent polyubiquitination by the UBE2V1-UBE2N heterodimer.

Subcellular Location:

Nucleus. Nucleus>PML body.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Broadly expressed.

Subunit Structure:

Interacts with SAE2 and UBE2I. Interacts with ZNF451. Identified in a complex with ZNF451 and UBE2I/UBC9, where one ZNF451 interacts with one UBE2I/UBC9 and two SUMO2 chains, one bound to the UBE2I/UBC9 active site and the other to another region of the same UBE2I/UBC9 molecule. Covalently attached to a number of proteins. Interacts with PELP1. Interacts with USP25; the interaction sumoylates USP25. Interacts with SIMC1, CASP8AP2, RNF111 AND SOBP (via SIM domains). Interacts with MTA1. Interacts with Epstein-barr virus BGLF4.

Similarity:

Belongs to the ubiquitin family. SUMO subfamily.

Research Fields

Research Fields:

· Genetic Information Processing > Translation > RNA transport.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF7024-BP
(Blocking peptide available as DF7024-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Horse
100%
Bovine
100%
Dog
100%
Xenopus
100%
Zebrafish
100%
Chicken
100%
Rabbit
100%
Sheep
0%
High similarity Medium similarity Low similarity No similarity
P61956 as Substrate
Site PTM Type Enzyme
K5 Acetylation
K5 Sumoylation
K5 Ubiquitination
K7 Sumoylation
K7 Ubiquitination
K11 Acetylation
K11 Sumoylation
K11 Ubiquitination
T12 Phosphorylation
K21 Sumoylation
K21 Ubiquitination
S28 Phosphorylation
K33 Acetylation
K33 Methylation
K33 Sumoylation
K33 Ubiquitination
K35 Ubiquitination
T38 Phosphorylation
K42 Acetylation
K42 Sumoylation
K42 Ubiquitination
K45 Acetylation
K45 Methylation
K45 Sumoylation
K45 Ubiquitination
R50 Methylation
S54 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top