HMGA2 Antibody - #DF7126
| Product: | HMGA2 Antibody |
| Catalog: | DF7126 |
| Description: | Rabbit polyclonal antibody to HMGA2 |
| Application: | WB |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep |
| Mol.Wt.: | 12kDa; 12kD(Calculated). |
| Uniprot: | P52926 |
| RRID: | AB_2839080 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7126, RRID:AB_2839080.
Fold/Unfold
HMGA 2; BABL; High mobility group (nonhistone chromosomal) protein isoform I C; High mobility group (nonhistone chromosomal) protein isoform IC; High Mobility Group AT hook 2; High Mobility Group AT hook protein 2; High mobility group AT-hook protein 2; High mobility group protein HMGI C; High mobility group protein HMGI-C; High mobility group protein HMGIC; High mobility group protein I, isoform C; HMGA2; HMGA2_HUMAN; HMGI C; HMGIC; LIPO; Non histone chromosomal architectural protein HMGI C; Non histone chromosomal architectural protein HMGIC; Pygmy; STQTL9;
Immunogens
A synthesized peptide derived from human HMGA2, corresponding to a region within C-terminal amino acids.
- P52926 HMGA2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Functions as a transcriptional regulator. Functions in cell cycle regulation through CCNA2. Plays an important role in chromosome condensation during the meiotic G2/M transition of spermatocytes. Plays a role in postnatal myogenesis, is involved in satellite cell activation (By similarity).
Regulated by cell cycle-dependent phosphorylation which alters its DNA binding affinity. Phosphorylated by NEK2 (By similarity).
Nucleus.
Belongs to the HMGA family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
References
Application: WB Species: human Sample: SiHa and HeLa cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.