VAPB Antibody - #DF7303

(1)  
Product: VAPB Antibody
Catalog: DF7303
Description: Rabbit polyclonal antibody to VAPB
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 27kDa; 27kD(Calculated).
Uniprot: O95292
RRID: AB_2839241

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
VAPB Antibody detects endogenous levels of total VAPB.
RRID:
AB_2839241
Cite Format: Affinity Biosciences Cat# DF7303, RRID:AB_2839241.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ALS 8; ALS8; D2Abb2e; UNQ484/PRO983; Vamp 33b; VAMP associated 33 kDa protein; VAMP associated protein B and C; VAMP associated protein B; VAMP associated protein B/C; VAMP associated protein C; VAMP B; VAMP B VAMP C; VAMP B/VAMP C; VAMP C; VAMP vesicle associated membrane protein associated protein B and C; Vamp33b; VAMPB; VAMPB/VAMPC; VAMPC; VAP 33b; VAP B; VAP B/VAP C; VAP C; VAP33b; VAPB/VAPC; VAPC; Vesicle associated membrane protein associated protein B and C; Vesicle associated membrane protein associated protein B/C;

Immunogens

Immunogen:
Uniprot:

O95292(VAPB_HUMAN) >>Visit HPA database.

Gene(ID):
VAPB(9217)
Expression:
O95292 VAPB_HUMAN:

Ubiquitous. Isoform 1 predominates.

Description:
The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking.
Sequence:
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL

PTMs - O95292 As Substrate

Site PTM Type Enzyme
A2 Acetylation
K3 Acetylation
K3 Ubiquitination
S9 Phosphorylation
K17 Ubiquitination
T23 Phosphorylation
T27 Phosphorylation
T28 Phosphorylation
R38 Methylation
K43 Methylation
K118 Acetylation
K118 Ubiquitination
K131 Ubiquitination
K139 Ubiquitination
S142 Phosphorylation
T143 Phosphorylation
S146 Phosphorylation
K147 Acetylation
K147 Sumoylation
K147 Ubiquitination
T150 Phosphorylation
S154 Phosphorylation
K155 Ubiquitination
S156 Phosphorylation
S158 Phosphorylation
S159 Phosphorylation
S160 Phosphorylation
T164 Phosphorylation
K188 Ubiquitination
T201 Phosphorylation
S204 Phosphorylation
S206 Phosphorylation
S209 Phosphorylation
T214 Phosphorylation
K216 Acetylation
S221 Phosphorylation
T222 Phosphorylation

Research Backgrounds

Function:

Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation.

Subcellular Location:

Endoplasmic reticulum membrane>Single-pass type IV membrane protein.
Note: Present in mitochondria-associated membranes that are endoplasmic reticulum membrane regions closely apposed to the outer mitochondrial membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitous. Isoform 1 predominates.

Subunit Structure:

Homodimer, and heterodimer with VAPA. Interacts with VAMP1 and VAMP2. Interacts (via MSP domain) with ZFYVE27. Interacts with RMDN3. Interacts with KIF5A in a ZFYVE27-dependent manner. Interacts with STARD3 (via FFAT motif). Interacts with STARD3NL (via FFAT motif). Interacts with CERT1.

(Microbial infection) Interacts with HCV protein NS5A and NS5B.

Family&Domains:

Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family.

Research Fields

· Organismal Systems > Digestive system > Cholesterol metabolism.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.