S100A11 Antibody - #DF7368
Product: | S100A11 Antibody |
Catalog: | DF7368 |
Description: | Rabbit polyclonal antibody to S100A11 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 11kDa; 12kD(Calculated). |
Uniprot: | P31949 |
RRID: | AB_2839306 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7368, RRID:AB_2839306.
Fold/Unfold
Calgizzarin; Epididymis secretory protein Li 43; HEL S 43; Metastatic lymph node gene 70 protein; MLN 70; MLN70; Protein S100 A11; Protein S100-A11, N-terminally processed; Protein S100-C; Protein S100A11; Protein S100C; S100 A11; S100 calcium binding protein A11; S100 calcium-binding protein A11 (calgizzarin); S100 calcium-binding protein A11; S100a11; S100C; S10AB_HUMAN;
Immunogens
- P31949 S10AB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P31949 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
A2 | Acetylation | Uniprot | |
K3 | Acetylation | Uniprot | |
K3 | Ubiquitination | Uniprot | |
S5 | Phosphorylation | Uniprot | |
S6 | Phosphorylation | Uniprot | |
T8 | Phosphorylation | Uniprot | |
T10 | Phosphorylation | Uniprot | |
C13 | S-Nitrosylation | Uniprot | |
S16 | Phosphorylation | Uniprot | |
K23 | Ubiquitination | Uniprot | |
Y24 | Phosphorylation | Uniprot | |
K27 | Acetylation | Uniprot | |
K27 | Ubiquitination | Uniprot | |
Y30 | Phosphorylation | Uniprot | |
Y32 | Phosphorylation | Uniprot | |
T33 | Phosphorylation | Uniprot | |
S35 | Phosphorylation | Uniprot | |
T37 | Phosphorylation | Uniprot | |
S41 | Phosphorylation | Uniprot | |
K52 | Ubiquitination | Uniprot | |
K55 | Ubiquitination | Uniprot | |
R62 | Methylation | Uniprot | |
K65 | Acetylation | Uniprot | |
K65 | Ubiquitination | Uniprot | |
K66 | Acetylation | Uniprot | |
T69 | Phosphorylation | Uniprot | |
S71 | Phosphorylation | Uniprot | |
S78 | Phosphorylation | Uniprot | |
S94 | Phosphorylation | Uniprot | |
K97 | Ubiquitination | Uniprot | |
S101 | Phosphorylation | Uniprot | |
T105 | Phosphorylation | Uniprot |
Research Backgrounds
Facilitates the differentiation and the cornification of keratinocytes.
Phosphorylation at Thr-10 by PRKCA significantly suppresses homodimerization and promotes association with NCL/nucleolin which induces nuclear translocation.
Cytoplasm. Nucleus.
Homodimer; disulfide-linked.
Belongs to the S-100 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.