CD74 Antibody - #DF7449
| Product: | CD74 Antibody |
| Catalog: | DF7449 |
| Description: | Rabbit polyclonal antibody to CD74 |
| Application: | WB IHC |
| Reactivity: | Human, Rat |
| Prediction: | Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 33kDa; 34kD(Calculated). |
| Uniprot: | P04233 |
| RRID: | AB_2839386 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7449, RRID:AB_2839386.
Fold/Unfold
CD 74; CD74; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); CD74 antigen; CD74 molecule; CD74 molecule, major histocompatibility complex, class II invariant chain; CLIP; DHLAG; Gamma chain of class II antigens; HG2A_HUMAN; HLA class II histocompatibility antigen gamma chain; HLA DR antigens associated invariant chain; HLA DR gamma; HLA-DR antigens-associated invariant chain; HLA-DR-gamma; HLADG; HLADR antigens associated invariant chain; Ia antigen associated invariant chain; Ia antigen-associated invariant chain; Ia associated invariant chain; Ia gamma; Ii; Invariant polypeptide of major histocompatibility complex class II antigen associated; la-gamma; Major histocompatibility complex class II invariant chain; MHC HLA DR gamma chain; MHC HLA-DR gamma chain; p33; p35; Protein 41;
Immunogens
- P04233 HG2A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P04233 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S8 | Phosphorylation | Uniprot | |
| K14 | Ubiquitination | Uniprot | |
| S25 | Phosphorylation | Uniprot | |
| S42 | Phosphorylation | Uniprot | |
| K43 | Ubiquitination | Uniprot | |
| S45 | Phosphorylation | Uniprot | |
| K80 | Ubiquitination | Uniprot | |
| K96 | Methylation | Uniprot | |
| K99 | Methylation | Uniprot | |
| T132 | Phosphorylation | Uniprot | |
| N136 | N-Glycosylation | Uniprot | |
| K159 | Ubiquitination | Uniprot | |
| K170 | Ubiquitination | Uniprot | |
| S197 | O-Glycosylation | Uniprot | |
| T203 | O-Glycosylation | Uniprot | |
| N256 | N-Glycosylation | Uniprot | |
| S281 | O-Glycosylation | Uniprot | |
| T287 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.
Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.
N- and O-glycosylated. O-glycosylated with core 1 or possibly core 8 glycans.
Cell membrane>Single-pass type II membrane protein. Endoplasmic reticulum membrane. Golgi apparatus>trans-Golgi network. Endosome. Lysosome.
Note: Transits through a number of intracellular compartments in the endocytic pathway. It can either undergo proteolysis or reach the cell membrane.
Homotrimer. In the endoplasmic reticulum (ER) it forms a heterononameric MHC II-Ii complex: 3 MHC class II molecules (heterodimers of an alpha and a beta subunit) bind to the CD74 homotrimer (also known as invariant chain or HLA class II histocompatibility antigen gamma chain). In the endosomal/lysosomal system, the CD74 component undergoes sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide) attached to the MHC class II molecule (alpha-beta-CLIP complex). This processed complex interacts with HLA_DM and HLA_DO heterodimers in order to release CLIP and facilitate the binding of antigenic peptides to the MHC class II molecules. Interacts with CD44; this complex is essential for the MIF-induced signaling cascade that results in B cell survival.
Research Fields
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.