Tubulin beta Antibody | Affinity Biosciences

Product:	Tubulin beta Antibody
Catalog:	AF7011
Description:	Rabbit polyclonal antibody to Tubulin beta
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	55kDa; 50kD(Calculated).
Uniprot:	P07437
RRID:	AB_2827688

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
50ul	$150	In stock
100ul	$250	In stock
200ul	$350	In stock
1ml	$1200	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:1000-1:5000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

Tubulin beta Antibody detects endogenous levels of total Tubulin beta.

RRID:

AB_2827688
Cite Format: Affinity Biosciences Cat# AF7011, RRID:AB_2827688.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

TUBB3, CDCBM, Beta III Tubulin, Class III beta-tubulin, TUBB4, Tubulin, beta 3, Tubulin beta-III, Tubulin beta-3 chain, Tubulin beta-4 chain, Tubulin, beta 3 class III, CFEOM3A

Immunogens

Immunogen:

A synthesized peptide derived from human Tubulin beta.

Uniprot:

P07437(TBB5_HUMAN) >>Visit HPA database.

Gene(ID):

TUBB(203068)

Expression:

P07437 TBB5_HUMAN:

Ubiquitously expressed with highest levels in spleen, thymus and immature brain.

Description:

TUBB3 Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. TUBB3 plays a critical role in proper axon guidance and mantainance.

Sequence:

P07437 TBB5_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA

PTMs - P07437 As Substrate

P07437

Site	PTM Type	Enzyme	Source
R2	Methylation		Uniprot
C12	S-Nitrosylation		Uniprot
K19	Acetylation		Uniprot
K19	Methylation		Uniprot
K19	Ubiquitination		Uniprot
S25	Phosphorylation		Uniprot
T33	Phosphorylation		Uniprot
T35	Phosphorylation		Uniprot
Y36	Phosphorylation		Uniprot
S40	Phosphorylation		Uniprot
R46	Methylation		Uniprot
S48	Phosphorylation		Uniprot
Y50	Phosphorylation		Uniprot
Y51	Phosphorylation		Uniprot
T55	Phosphorylation		Uniprot
K58	Acetylation		Uniprot
K58	Methylation		Uniprot
K58	Sumoylation		Uniprot
K58	Ubiquitination		Uniprot
Y59	Phosphorylation		Uniprot
T72	Phosphorylation		Uniprot
S75	Phosphorylation		Uniprot
S78	Phosphorylation		Uniprot
S95	Phosphorylation		Uniprot
K103	Acetylation		Uniprot
K103	Sumoylation		Uniprot
K103	Ubiquitination		Uniprot
Y106	Phosphorylation		Uniprot
T107	Phosphorylation		Uniprot
S115	Phosphorylation		Uniprot
K122	Ubiquitination		Uniprot
S126	Phosphorylation		Uniprot
T136	Phosphorylation		Uniprot
S138	Phosphorylation		Uniprot
T143	Phosphorylation		Uniprot
S145	Phosphorylation		Uniprot
T149	Phosphorylation		Uniprot
S153	Phosphorylation		Uniprot
K154	Ubiquitination		Uniprot
Y159	Phosphorylation		Uniprot
R162	Methylation		Uniprot
T166	Phosphorylation		Uniprot
S168	Phosphorylation		Uniprot
S172	Phosphorylation		Uniprot
K174	Ubiquitination		Uniprot
Y183	Phosphorylation		Uniprot
T196	Phosphorylation		Uniprot
T199	Phosphorylation		Uniprot
Y200	Phosphorylation		Uniprot
Y208	Phosphorylation		Uniprot
K216	Ubiquitination		Uniprot
T218	Phosphorylation		Uniprot
T219	Phosphorylation		Uniprot
T221	Phosphorylation		Uniprot
Y222	Phosphorylation		Uniprot
S234	Phosphorylation		Uniprot
C239	S-Nitrosylation		Uniprot
K252	Sumoylation		Uniprot
K252	Ubiquitination		Uniprot
T274	Phosphorylation		Uniprot
S275	Phosphorylation	Q5TCY1 (TTBK1)	Uniprot
R276	Methylation		Uniprot
S278	Phosphorylation		Uniprot
Y281	Phosphorylation		Uniprot
T285	Phosphorylation		Uniprot
T290	Phosphorylation		Uniprot
K297	Ubiquitination		Uniprot
C303	S-Nitrosylation		Uniprot
Y310	Phosphorylation		Uniprot
T312	Phosphorylation		Uniprot
R318	Methylation		Uniprot
S322	Phosphorylation		Uniprot
K324	Acetylation		Uniprot
K324	Sumoylation		Uniprot
K324	Ubiquitination		Uniprot
K336	Acetylation		Uniprot
K336	Ubiquitination		Uniprot
S338	Phosphorylation		Uniprot
S339	Phosphorylation		Uniprot
Y340	Phosphorylation		Uniprot
K350	Sumoylation		Uniprot
K350	Ubiquitination		Uniprot
T351	Phosphorylation		Uniprot
K362	Ubiquitination		Uniprot
T366	Phosphorylation		Uniprot
S371	Phosphorylation		Uniprot
K379	Acetylation		Uniprot
K379	Ubiquitination		Uniprot
S382	Phosphorylation		Uniprot
T386	Phosphorylation		Uniprot
K392	Ubiquitination		Uniprot
T399	Phosphorylation		Uniprot
Y422	Phosphorylation		Uniprot
Y425	Phosphorylation		Uniprot
T429	Phosphorylation		Uniprot

Research Backgrounds

P07437_TBB5_HUMAN

Function:

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.

PTMs:

Some glutamate residues at the C-terminus are polyglutamylated, resulting in polyglutamate chains on the gamma-carboxyl group. Polyglutamylation plays a key role in microtubule severing by spastin (SPAST). SPAST preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity by SPAST increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold.

Some glutamate residues at the C-terminus are monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into axonemes (cilia and flagella). Both polyglutamylation and monoglycylation can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally. The precise function of monoglycylation is still unclear (Probable).

Phosphorylated on Ser-172 by CDK1 during the cell cycle, from metaphase to telophase, but not in interphase. This phosphorylation inhibits tubulin incorporation into microtubules.

Subcellular Location:

Cytoplasm>Cytoskeleton.

Tissue Specificity:

Ubiquitously expressed with highest levels in spleen, thymus and immature brain.

Subunit Structure:

Heterodimer of alpha and beta chains. A typical microtubule is a hollow water-filled tube with an outer diameter of 25 nm and an inner diameter of 15 nM. Alpha-beta heterodimers associate head-to-tail to form protofilaments running lengthwise along the microtubule wall with the beta-tubulin subunit facing the microtubule plus end conferring a structural polarity. Microtubules usually have 13 protofilaments but different protofilament numbers can be found in some organisms and specialized cells. Interacts with PIFO. Interacts with DIAPH1. Interacts with MX1 (By similarity). May interact with RNABP10 (By similarity). Interacts with CFAP157 (By similarity).

Family&Domains:

The highly acidic C-terminal region may bind cations such as calcium.

Belongs to the tubulin family.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Gap junction. (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.

References

1). The Nuclear Matrix Protein SAFA Surveils Viral RNA and Facilitates Immunity by Activating Antiviral Enhancers and Super-enhancers. Cell Host & Microbe (PubMed: 31513772) [IF=30.3]

Application: WB Species: human Sample: HEK293 cells

Figure 3.| Oligomerized SAFA Mediates IFNb Transcription(I) HEK293 cells were transfected with indicated plasmids and infected with virus for 6 h, followed by oligomerization assay.

2). SOX9 Modulates the Transformation of Gastric Stem Cells Through Biased Symmetric Cell Division. Gastroenterology (PubMed: 36740200) [IF=29.4]

3). The microglial innate immune receptors TREM-1 and TREM-2 in the anterior cingulate cortex (ACC) drive visceral hypersensitivity and depressive-like behaviors following DSS-induced colitis. Brain, Behavior, and Immunity (PubMed: 37286175) [IF=15.1]

4). Circular RNA circBbs9 promotes PM2. 5-induced lung inflammation in mice via NLRP3 inflammasome activation. ENVIRONMENT INTERNATIONAL (PubMed: 32707273) [IF=11.8]

Application: WB Species: mouse Sample: lung

Fig. 3. Involvement of the NLRP3 inflammasome pathway in PM2.5-induced inflammatory response. (A) The mRNA expression of NLRP3 was examined in lung tissue from normal and COPD model mice. (B) The mRNA expression of NLRP3 was examined in RAW264.7 cells exposed to PM2.5. (C) The immunohistochemistry images of NLRP3 protein were analyzed in FA and PM2.5 exposed groups of normal and COPD model mice. (D) The score of lung tissue NLRP3 protein immunohistochemistry between FA and PM2.5 exposed mice. (E) The protein expression of NLRP3 inflammasome-related genes NLRP3, caspase-1, cleaved-caspase-1, IL-1β, and IL-18, were detected by western blot in normal and COPD model mouse lung tissue. Relative expression levels of NLRP3, caspase-1, cleaved-caspase-1, IL-1β, and IL-18 are shown in F-J. (K) The protein expression level of NLRP3 inflammasome-related genes, including NLRP3, caspase-1, cleaved-caspase-1, IL-1β, and IL-18, were analyzed in RAW264.7 cells exposed to PM2.5 for 24 h and 48 h. (L) Relative expression levels of NLRP3, caspase-1, cleaved-caspase-1, IL-1β, and IL-18 in RAW264.7 cells between the control and PM2.5 exposed group. The (M) mRNA and (N, O) protein expression levels of NLRP3 inflammasome-related genes were detected after treatment with NLRP3 siRNA and PM2.5 exposure, respectively. *p < 0.05, **p < 0.01, ***p < 0.001.

5). Circulating proteomic panels for risk stratification of intracranial aneurysm and its rupture. EMBO Molecular Medicine (PubMed: 34978375) [IF=11.1]

Application: WB Species: Human Sample: IA tissue

Figure 2 IA tissue proteome remodeling due to IA formation and rupture Five pairs of IA and STA tissues surgically excised from intracranial aneurysm patients. Differentially expressed proteins between IA group and STA group, as determined by plotting Student’s t‐test (P‐value < 0.05, two‐sided) P‐values versus the log2 fold change (IA/STA) are represented on volcano plots. Proteins with significant change in expression levels are indicated by pink (upregulated) and blue (downregulated) dots. The dashed line (x = ±1) represents the cutoff of the log2 fold change in protein levels, and dashed line (y = 2) represents the cutoff of the −log10 t‐test P‐value. Significantly altered top ranked pathways in IA tissues compared with STA tissues. Interaction network of tissue downregulated proteins in IA group compared to STA group. Western blot validation of selected protein (PDLIM1) differentially expressed between STA and IA. Downregulation of PDLIM1 in IA tissue as compared to STA tissue was confirmed. Immunoblots showing expression differences of PDLIM1 in STA and IA specimens are shown in the left panel using β‐tubulin as the loading control. The semi‐quantitative densitometric measurement of blot bands is summarized in the lower panel. Error bars indicate standard deviations (three biological replicates for each group, two‐tailed Student’s t‐test, * P‐value < 0.05).

6). Opsonized nanoparticles target and regulate macrophage polarization for osteoarthritis therapy: A trapping strategy. Journal of Controlled Release (PubMed: 35489544) [IF=10.8]

7). Glutamine‐based Metabolism Normalization and Oxidative Stress Alleviation by Self‐assembled bilirubin/V9302 Nanoparticles for Psoriasis Treatment. Advanced Healthcare Materials (PubMed: 36690435) [IF=10.0]

8). Nanomechanical vibration profiling of oocytes. Nano Research [IF=9.9]

9). A marine-derived small molecule induces immunogenic cell death against triple-negative breast cancer through ER stress-CHOP pathway. International Journal of Biological Sciences (PubMed: 35541893) [IF=9.2]

Application: WB Species: human Sample: MDA-MB-231 cells

Figure 2. | MHO7 induced ER stress and cell cycle arrest in TNBC cells.(D) The expression of BiP/p-PERK/p-eIF2α/ATF4/CHOP were measured by western blot under MHO7 treatment in MDA-MB-231 cells.

10). NLRP3-dependent microglial training impaired the clearance of amyloid-beta and aggravated the cognitive decline in Alzheimer’s disease. Cell Death & Disease (PubMed: 33051464) [IF=9.0]

Application: WB Species: mice Sample: cortex and hippocampus

Fig. 2 Histological and western blotting analysis of NACHT-, LRR-, and pyrin (PYD)-domain-containing protein 3 (NLRP3) activation. A Immunofluorescence staining of NLRP3 and ionized calcium-binding adapter molecule 1 (Iba1) (×63 oil immersion objective). B Comparisons of NLRP3 intensities in the cortex and hippocampus. C Chemiluminescence images of NLRP3, caspase-1 and β-tubulin, IL-1β and β-actin. D Comparisons of the NLRP3/β-tubulin, cleaved caspase-1/β-tubulin, and IL-1β/β-actin ratios. Each dataset is expressed as mean ± SD. *P ≤ 0.05; **P ≤ 0.01; ***P ≤ 0.001; ****P ≤ 0.0001. n = 6 mice

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Tubulin beta Antibody - #AF7011