Fragmentin 3; Fragmentin-3; Fragmentin3; GRAK_HUMAN; Granzyme 3; granzyme K (granzyme 3; tryptase II); granzyme K (serine protease, granzyme 3; tryptase II); Granzyme K; Granzyme K precursor; Granzyme-3; Granzyme3; GranzymeK; GZMK; NK TRYP 2; NK TRYP2; NK tryptase 2; NK-TRYP-2; NK-tryptase-2; NKTRYP2; Serine protease granzyme 3; TRYP 2; TRYP2; Tryptase II; TryptaseII;
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Human, Mouse, Rat
Pig(100%), Bovine(100%), Horse(91%), Sheep(100%), Rabbit(90%), Dog(100%)
Rabbit
Polyclonal
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Granzyme K Antibody detects endogenous levels of total Granzyme K.
AB_2839585
Please cite this product as: Affinity Biosciences Cat# DF2377, RRID:AB_2839585.
Liquid
1mg/ml
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
A synthesized peptide derived from human Granzyme K, corresponding to a region within the internal amino acids.
>>Visit The Human Protein Atlas
GZMK
Observed Mol.Wt.: 34kD.
Predicted Mol.Wt.: 29kDa(Calculated)..
Secreted. Cytoplasmic granule.
P49863 GRAK_HUMAN:
Expressed in lung, spleen, thymus and peripheral blood leukocytes.
MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN
Secreted. Cytoplasmic granule.
Expressed in lung, spleen, thymus and peripheral blood leukocytes.
Belongs to the peptidase S1 family. Granzyme subfamily.
DF2377-BP
(Blocking peptide available as DF2377-BP)
$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).
Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.
Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y17 | Phosphorylation | Uniprot | |
T96 | Phosphorylation | Uniprot | |
Y186 | Phosphorylation | Uniprot | |
Y187 | Phosphorylation | Uniprot | |
T252 | Phosphorylation | Uniprot | |
S256 | Phosphorylation | Uniprot | |
T263 | Phosphorylation | Uniprot |