Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    Granzyme K Antibody
  • Catalog No.
    DF2377
  • RRID
    AB_2839585
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig(100%), Bovine(100%), Horse(91%), Sheep(100%), Rabbit(90%), Dog(100%)
  • UniProt
  • Mol.Wt
    34kD;
    29kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Fragmentin 3; Fragmentin-3; Fragmentin3; GRAK_HUMAN; Granzyme 3; granzyme K (granzyme 3; tryptase II); granzyme K (serine protease, granzyme 3; tryptase II); Granzyme K; Granzyme K precursor; Granzyme-3; Granzyme3; GranzymeK; GZMK; NK TRYP 2; NK TRYP2; NK tryptase 2; NK-TRYP-2; NK-tryptase-2; NKTRYP2; Serine protease granzyme 3; TRYP 2; TRYP2; Tryptase II; TryptaseII;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig(100%), Bovine(100%), Horse(91%), Sheep(100%), Rabbit(90%), Dog(100%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

Granzyme K Antibody detects endogenous levels of total Granzyme K.

RRID:

AB_2839585
Please cite this product as: Affinity Biosciences Cat# DF2377, RRID:AB_2839585.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

Immunogen Information

Immunogen:

A synthesized peptide derived from human Granzyme K, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

GZMK

Molecular Weight:

Observed Mol.Wt.: 34kD.
Predicted Mol.Wt.: 29kDa(Calculated)..

Subcellular Location:

Secreted. Cytoplasmic granule.

Tissue Specificity:

P49863 GRAK_HUMAN:
Expressed in lung, spleen, thymus and peripheral blood leukocytes.

Sequence:
MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN

Research Background

Subcellular Location:

Secreted. Cytoplasmic granule.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Expressed in lung, spleen, thymus and peripheral blood leukocytes.

Similarity:

Belongs to the peptidase S1 family. Granzyme subfamily.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF2377-BP
(Blocking peptide available as DF2377-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Bovine
100%
Sheep
100%
Dog
100%
Horse
91%
Rabbit
90%
Xenopus
0%
Zebrafish
0%
Chicken
0%
High similarity Medium similarity Low similarity No similarity
P49863 as Substrate
Site PTM Type Enzyme
Y17 Phosphorylation
T96 Phosphorylation
Y186 Phosphorylation
Y187 Phosphorylation
T252 Phosphorylation
S256 Phosphorylation
T263 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top