FOXO1/3/4 Antibody - #BF0211
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# BF0211, RRID:AB_2833989.
Fold/Unfold
FKH 1; FKH1; FKHR; Forkhead (Drosophila) homolog 1 (rhabdomyosarcoma); Forkhead box O1; Forkhead box protein O1; Forkhead box protein O1A; Forkhead in rhabdomyosarcoma; Forkhead, Drosophila, homolog of, in rhabdomyosarcoma; FoxO transcription factor; foxo1; FOXO1_HUMAN; FOXO1A; OTTHUMP00000018301; AF6q21; AF6q21 protein; DKFZp781A0677; FKHR2; FKHRL 1; FKHRL1; FKHRL1P2; Forkhead (Drosophila) homolog (rhabdomyosarcoma) like 1; Forkhead box O3; Forkhead box O3A; Forkhead box protein O3; Forkhead box protein O3A; Forkhead Drosophila homolog of in rhabdomyosarcoma like 1; Forkhead homolog (rhabdomyosarcoma) like 1; Forkhead in rhabdomyosarcoma like 1; Forkhead in rhabdomyosarcoma-like 1; FOX O3A; FOXO2; foxo3; FOXO3_HUMAN; FOXO3A; MGC12739; MGC31925; AFX; AFX1; Afxh; ALL1-fused gene from X chromosome; Fork head domain transcription factor AFX1; Forkhead box O4; Forkhead box protein O4; FOXO 4; Foxo4; FOXO4_HUMAN; MGC117660; MGC120490; Mixed lineage leukemia, translocated to, 7; MLLT7; Myeloid/lymphoid or mixed lineage leukemia (trithorax homolog, Drosophila); translocated to, 7; Myeloid/lymphoid or mixed lineage leukemia, translocated to, 7; RGD1561201;
Immunogens
Purified recombinant fragment of human FOXO1 expressed in E. Coli.
Ubiquitous.
O43524 FOXO3_HUMAN:Ubiquitous.
P98177 FOXO4_HUMAN:Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Isoform zeta is most abundant in the liver, kidney, and pancreas.
- Q12778 FOXO1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
- O43524 FOXO3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG
- P98177 FOXO4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDPGNENSATEAAAIIDLDPDFEPQSRPRSCTWPLPRPEIANQPSEPPEVEPDLGEKVHTEGRSEPILLPSRLPEPAGGPQPGILGAVTGPRKGGSRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGGKSGKAPRRRAASMDSSSKLLRGRSKAPKKKPSVLPAPPEGATPTSPVGHFAKWSGSPCSRNREEADMWTTFRPRSSSNASSVSTRLSPLRPESEVLAEEIPASVSSYAGGVPPTLNEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLGGLPSSSKLATGVGLCPKPLEAPGPSSLVPTLSMIAPPPVMASAPIPKALGTPVLTPPTEAASQDRMPQDLDLDMYMENLECDMDNIISDLMDEGEGLDFNFEPDP
PTMs - Q12778/O43524/P98177 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S7 | Phosphorylation | Q16539 (MAPK14) | Uniprot |
S12 | Phosphorylation | Q16539 (MAPK14) | Uniprot |
S26 | Phosphorylation | Uniprot | |
S30 | Phosphorylation | Uniprot | |
T32 | Phosphorylation | Q9Y243 (AKT3) , Q9HBY8 (SGK2) , P67775 (PPP2CA) , P11309-2 (PIM1) , P31751 (AKT2) , P31749 (AKT1) , O00141 (SGK1) | Uniprot |
S43 | Phosphorylation | Uniprot | |
K46 | Methylation | Uniprot | |
S75 | Phosphorylation | Uniprot | |
S90 | Phosphorylation | Uniprot | |
K149 | Methylation | Uniprot | |
S161 | Phosphorylation | Uniprot | |
Y162 | Phosphorylation | Uniprot | |
S173 | Phosphorylation | Uniprot | |
T179 | Phosphorylation | Q13131 (PRKAA1) , P54646 (PRKAA2) | Uniprot |
Y184 | Phosphorylation | Uniprot | |
K207 | Ubiquitination | Uniprot | |
S209 | Phosphorylation | Q13043 (STK4) | Uniprot |
S215 | Phosphorylation | Q13043 (STK4) , Q8IW41 (MAPKAPK5) | Uniprot |
K230 | Methylation | Uniprot | |
S231 | Phosphorylation | Q13043 (STK4) | Uniprot |
S232 | Phosphorylation | Q13043 (STK4) | Uniprot |
K242 | Acetylation | Uniprot | |
S243 | Phosphorylation | Q13043 (STK4) | Uniprot |
K245 | Acetylation | Uniprot | |
S253 | Phosphorylation | Q9Y243 (AKT3) , O00141 (SGK1) , Q96BR1 (SGK3) , Q9HBY8 (SGK2) , P11309-2 (PIM1) , P31749 (AKT1) , P31751 (AKT2) | Uniprot |
K259 | Acetylation | Uniprot | |
K262 | Methylation | Uniprot | |
K271 | Acetylation | Uniprot | |
K271 | Methylation | Uniprot | |
S280 | Phosphorylation | Uniprot | |
S284 | Phosphorylation | Uniprot | |
S286 | Phosphorylation | Uniprot | |
S289 | Phosphorylation | Uniprot | |
K290 | Acetylation | Uniprot | |
K290 | Methylation | Uniprot | |
S294 | Phosphorylation | P28482 (MAPK1) , Q16539 (MAPK14) , P27361 (MAPK3) | Uniprot |
T296 | Phosphorylation | Uniprot | |
S297 | Phosphorylation | Uniprot | |
S299 | Phosphorylation | Uniprot | |
T307 | Phosphorylation | Uniprot | |
S311 | Phosphorylation | Uniprot | |
S315 | Phosphorylation | P31749 (AKT1) , O00141 (SGK1) , P31751 (AKT2) , Q9Y243 (AKT3) | Uniprot |
S318 | Phosphorylation | P48729 (CSNK1A1) | Uniprot |
T319 | Phosphorylation | Uniprot | |
S321 | Phosphorylation | P48729 (CSNK1A1) | Uniprot |
S325 | Phosphorylation | Uniprot | |
S330 | Phosphorylation | Q13627 (DYRK1A) | Uniprot |
S344 | Phosphorylation | Q16539 (MAPK14) , P27361 (MAPK3) , P28482 (MAPK1) | Uniprot |
S355 | Phosphorylation | Uniprot | |
T395 | Phosphorylation | Uniprot | |
S399 | Phosphorylation | P54646 (PRKAA2) , Q13131 (PRKAA1) | Uniprot |
S402 | Phosphorylation | Uniprot | |
S413 | Phosphorylation | P54646 (PRKAA2) , Q13131 (PRKAA1) | Uniprot |
K419 | Methylation | Uniprot | |
S421 | Phosphorylation | Uniprot | |
S425 | Phosphorylation | P27361 (MAPK3) , P28482 (MAPK1) , Q16539 (MAPK14) | Uniprot |
T427 | Phosphorylation | Uniprot | |
S439 | Phosphorylation | Uniprot | |
S551 | Phosphorylation | Uniprot | |
S553 | Phosphorylation | Uniprot | |
S555 | Phosphorylation | Q13131 (PRKAA1) , P54646 (PRKAA2) | Uniprot |
K569 | Acetylation | Uniprot | |
S574 | Phosphorylation | P45983 (MAPK8) | Uniprot |
S588 | Phosphorylation | P54646 (PRKAA2) , Q13131 (PRKAA1) | Uniprot |
S626 | Phosphorylation | P54646 (PRKAA2) , Q13131 (PRKAA1) | Uniprot |
S644 | Phosphorylation | Q14164 (IKBKE) , O15111 (CHUK) , O14920 (IKBKB) | Uniprot |
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Ubiquitination | Uniprot | ||
S26 | Phosphorylation | Uniprot | |
S30 | Phosphorylation | Uniprot | |
T32 | Phosphorylation | P31749 (AKT1) , P31751 (AKT2) | Uniprot |
S111 | Phosphorylation | Uniprot | |
K151 | Ubiquitination | Uniprot | |
S159 | Phosphorylation | Uniprot | |
K186 | Acetylation | Uniprot | |
K189 | Acetylation | Uniprot | |
S197 | Phosphorylation | P31749 (AKT1) | Uniprot |
S200 | Phosphorylation | Uniprot | |
T227 | Phosphorylation | P45983 (MAPK8) | Uniprot |
S230 | Phosphorylation | P45983 (MAPK8) | Uniprot |
S241 | Phosphorylation | Uniprot | |
S244 | Phosphorylation | Uniprot | |
S261 | Phosphorylation | Uniprot | |
S262 | Phosphorylation | P31749 (AKT1) | Uniprot |
S265 | Phosphorylation | Uniprot | |
S268 | Phosphorylation | Uniprot | |
S272 | Phosphorylation | Uniprot | |
S278 | Phosphorylation | Uniprot | |
S288 | Phosphorylation | Uniprot | |
Y292 | Phosphorylation | Uniprot | |
K407 | Acetylation | Uniprot | |
T451 | Phosphorylation | P45983 (MAPK8) , P45984 (MAPK9) | Uniprot |
T455 | Phosphorylation | P45984 (MAPK9) , P45983 (MAPK8) | Uniprot |
T458 | Phosphorylation | Uniprot |
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T24 | Phosphorylation | P31751 (AKT2) , P31749 (AKT1) , P11309-2 (PIM1) , PR:P31749 (hAKT1) | Uniprot |
S152 | Phosphorylation | Uniprot | |
S153 | Phosphorylation | Uniprot | |
S164 | Phosphorylation | Uniprot | |
T182 | Phosphorylation | Uniprot | |
S184 | Phosphorylation | Uniprot | |
S205 | Phosphorylation | Uniprot | |
K210 | Ubiquitination | Uniprot | |
S212 | Phosphorylation | Q13043 (STK4) | Uniprot |
S215 | Phosphorylation | Uniprot | |
S218 | Phosphorylation | Uniprot | |
K222 | Acetylation | Uniprot | |
S234 | Phosphorylation | Uniprot | |
S235 | Phosphorylation | Uniprot | |
K245 | Acetylation | Uniprot | |
S246 | Phosphorylation | P28482 (MAPK1) | Uniprot |
K248 | Acetylation | Uniprot | |
S249 | Phosphorylation | P06493 (CDK1) , Q00535 (CDK5) , P24941 (CDK2) , P11802 (CDK4) | Uniprot |
R251 | Methylation | Uniprot | |
R253 | Methylation | Uniprot | |
S256 | Phosphorylation | PR:P31749 (hAKT1) , Q13153 (PAK1) , Q16512 (PKN1) , P31749 (AKT1) , P31751 (AKT2) , P11309-2 (PIM1) | Uniprot |
K262 | Acetylation | Uniprot | |
K265 | Acetylation | Uniprot | |
K274 | Acetylation | Uniprot | |
S276 | Phosphorylation | Uniprot | |
S287 | Phosphorylation | Uniprot | |
S293 | Phosphorylation | Uniprot | |
K294 | Acetylation | Uniprot | |
S298 | Phosphorylation | Uniprot | |
S301 | Phosphorylation | Uniprot | |
S303 | Phosphorylation | Uniprot | |
T317 | O-Glycosylation | Uniprot | |
S318 | O-Glycosylation | Uniprot | |
S319 | Phosphorylation | PR:P31749 (hAKT1) , Q13237 (PRKG2) , P31749 (AKT1) , P11309-2 (PIM1) | Uniprot |
S322 | Phosphorylation | P48729 (CSNK1A1) , Q9HCP0 (CSNK1G1) | Uniprot |
T323 | Phosphorylation | Uniprot | |
S325 | Phosphorylation | P48729 (CSNK1A1) , P49841 (GSK3B) | Uniprot |
S329 | Phosphorylation | Q9UBE8 (NLK) , Q13627 (DYRK1A) | Uniprot |
T333 | Phosphorylation | Uniprot | |
S383 | Phosphorylation | Uniprot | |
S394 | Phosphorylation | Uniprot | |
T402 | Phosphorylation | Uniprot | |
S413 | Phosphorylation | P28482 (MAPK1) | Uniprot |
S416 | Phosphorylation | Q16539 (MAPK14) | Uniprot |
S418 | Phosphorylation | P28482 (MAPK1) | Uniprot |
S429 | Phosphorylation | P28482 (MAPK1) | Uniprot |
S430 | Phosphorylation | Uniprot | |
S432 | Phosphorylation | Q16539 (MAPK14) | Uniprot |
T467 | Phosphorylation | Uniprot | |
S470 | Phosphorylation | P28482 (MAPK1) , Q16539 (MAPK14) | Uniprot |
T478 | Phosphorylation | Q16539 (MAPK14) , P28482 (MAPK1) | Uniprot |
S505 | Phosphorylation | Uniprot | |
S509 | Phosphorylation | Uniprot | |
S550 | O-Glycosylation | Uniprot | |
T560 | Phosphorylation | Q16539 (MAPK14) , P28482 (MAPK1) | Uniprot |
K597 | Acetylation | Uniprot | |
T648 | O-Glycosylation | Uniprot | |
T649 | Phosphorylation | Q13131 (PRKAA1) | Uniprot |
S651 | Phosphorylation | Uniprot | |
S654 | O-Glycosylation | Uniprot |
Research Backgrounds
Transcription factor that is the main target of insulin signaling and regulates metabolic homeostasis in response to oxidative stress. Binds to the insulin response element (IRE) with consensus sequence 5'-TT[G/A]TTTTG-3' and the related Daf-16 family binding element (DBE) with consensus sequence 5'-TT[G/A]TTTAC-3'. Activity suppressed by insulin. Main regulator of redox balance and osteoblast numbers and controls bone mass. Orchestrates the endocrine function of the skeleton in regulating glucose metabolism. Acts synergistically with ATF4 to suppress osteocalcin/BGLAP activity, increasing glucose levels and triggering glucose intolerance and insulin insensitivity. Also suppresses the transcriptional activity of RUNX2, an upstream activator of osteocalcin/BGLAP. In hepatocytes, promotes gluconeogenesis by acting together with PPARGC1A and CEBPA to activate the expression of genes such as IGFBP1, G6PC and PCK1. Important regulator of cell death acting downstream of CDK1, PKB/AKT1 and STK4/MST1. Promotes neural cell death. Mediates insulin action on adipose tissue. Regulates the expression of adipogenic genes such as PPARG during preadipocyte differentiation and, adipocyte size and adipose tissue-specific gene expression in response to excessive calorie intake. Regulates the transcriptional activity of GADD45A and repair of nitric oxide-damaged DNA in beta-cells. Required for the autophagic cell death induction in response to starvation or oxidative stress in a transcription-independent manner. Mediates the function of MLIP in cardiomyocytes hypertrophy and cardiac remodeling (By similarity).
Phosphorylation by NLK promotes nuclear export and inhibits the transcriptional activity. In response to growth factors, phosphorylation on Thr-24, Ser-256 and Ser-322 by PKB/AKT1 promotes nuclear export and inactivation of transactivational activity. Phosphorylation on Thr-24 is required for binding 14-3-3 proteins. Phosphorylation of Ser-256 decreases DNA-binding activity and promotes the phosphorylation of Thr-24 and Ser-319, permitting phosphorylation of Ser-322 and Ser-325, probably by CDK1, leading to nuclear exclusion and loss of function. Stress signals, such as response to oxygen or nitric oxide, attenuate the PKB/AKT1-mediated phosphorylation leading to nuclear retention. Phosphorylation of Ser-329 is independent of IGF1 and leads to reduced function. Dephosphorylated on Thr-24 and Ser-256 by PP2A in beta-cells under oxidative stress leading to nuclear retention (By similarity). Phosphorylation of Ser-249 by CDK1 disrupts binding of 14-3-3 proteins leading to nuclear accumulation and has no effect on DNA-binding nor transcriptional activity. Phosphorylation by STK4/MST1 on Ser-212, upon oxidative stress, inhibits binding to 14-3-3 proteins and nuclear export.
Acetylated. Acetylation at Lys-262, Lys-265 and Lys-274 are necessary for autophagic cell death induction. Deacetylated by SIRT2 in response to oxidative stress or serum deprivation, thereby negatively regulating FOXO1-mediated autophagic cell death.
Ubiquitinated by SKP2. Ubiquitination leads to proteasomal degradation.
Methylation inhibits AKT1-mediated phosphorylation at Ser-256 and is increased by oxidative stress.
Once in the nucleus, acetylated by CREBBP/EP300. Acetylation diminishes the interaction with target DNA and attenuates the transcriptional activity. It increases the phosphorylation at Ser-256. Deacetylation by SIRT1 results in reactivation of the transcriptional activity. Oxidative stress by hydrogen peroxide treatment appears to promote deacetylation and uncoupling of insulin-induced phosphorylation. By contrast, resveratrol acts independently of acetylation.
Cytoplasm. Nucleus.
Note: Shuttles between the cytoplasm and nucleus. Largely nuclear in unstimulated cells. In osteoblasts, colocalizes with ATF4 and RUNX2 in the nucleus (By similarity). Insulin-induced phosphorylation at Ser-256 by PKB/AKT1 leads, via stimulation of Thr-24 phosphorylation, to binding of 14-3-3 proteins and nuclear export to the cytoplasm where it is degraded by the ubiquitin-proteosomal pathway. Phosphorylation at Ser-249 by CDK1 disrupts binding of 14-3-3 proteins and promotes nuclear accumulation. Phosphorylation by NLK results in nuclear export. Translocates to the nucleus upon oxidative stress-induced phosphorylation at Ser-212 by STK4/MST1. SGK1-mediated phosphorylation also results in nuclear translocation. Retained in the nucleus under stress stimuli including oxidative stress, nutrient deprivation or nitric oxide. Retained in the nucleus on methylation.
Ubiquitous.
Interacts with LRPPRC. Interacts with RUNX2; the interaction inhibits RUNX2 transcriptional activity and mediates the IGF1/insulin-dependent BGLAP expression in osteoblasts Interacts with PPP2R1A; the interaction regulates the dephosphorylation of FOXO1 at Thr-24 and Ser-256 leading to its nuclear import. Interacts (acetylated form) with PPARG. Interacts with XBP1 isoform 2; this interaction is direct and leads to FOXO1 ubiquitination and degradation via the proteasome pathway (By similarity). Interacts with NLK. Interacts with SIRT1; the interaction results in the deacetylation of FOXO1 leading to activation of FOXO1-mediated transcription of genes involved in DNA repair and stress resistance. Binds to CDK1. Interacts with the 14-3-3 proteins, YWHAG and YWHAZ; the interactions require insulin-stimulated phosphorylation on Thr-24, promote nuclear exit and loss of transcriptional activity. Interacts with SKP2; the interaction ubiquitinates FOXO1 leading to its proteosomal degradation. The interaction requires the presence of KRIT1. Interacts (via the C-terminal half) with ATF4 (via its DNA-binding domain); the interaction occurs in osteoblasts, regulates glucose homeostasis via suppression of beta-cell proliferation and subsequent decrease in insulin production. Interacts with PRMT1; the interaction methylates FOXO1, prevents PKB/AKT1 phosphorylation and retains FOXO1 in the nucleus. Interacts with EP300 and CREBBP; the interactions acetylate FOXO1. Interacts with SIRT2; the interaction is disrupted in response to oxidative stress or serum deprivation, leading to increased level of acetylated FOXO1, which promotes stress-induced autophagy by stimulating E1-like activating enzyme ATG7. Interacts (acetylated form) with ATG7; the interaction is increased in response to oxidative stress or serum deprivation and promotes the autophagic process leading to cell death. Interacts (via the Fork-head domain) with CEBPA; the interaction increases when FOXO1 is deacetylated. Interacts with WDFY2. Forms a complex with WDFY2 and AKT1 (By similarity). Interacts with CRY1 (By similarity).
Transcriptional activator that recognizes and binds to the DNA sequence 5'-[AG]TAAA[TC]A-3' and regulates different processes, such as apoptosis and autophagy. Acts as a positive regulator of autophagy in skeletal muscle: in starved cells, enters the nucleus following dephosphorylation and binds the promoters of autophagy genes, such as GABARAP1L, MAP1LC3B and ATG12, thereby activating their expression, resulting in proteolysis of skeletal muscle proteins (By similarity). Triggers apoptosis in the absence of survival factors, including neuronal cell death upon oxidative stress. Participates in post-transcriptional regulation of MYC: following phosphorylation by MAPKAPK5, promotes induction of miR-34b and miR-34c expression, 2 post-transcriptional regulators of MYC that bind to the 3'UTR of MYC transcript and prevent its translation. In response to metabolic stress, translocates into the mitochondria where it promotes mtDNA transcription.
In the presence of survival factors such as IGF-1, phosphorylated on Thr-32 and Ser-253 by AKT1/PKB. This phosphorylated form then interacts with 14-3-3 proteins and is retained in the cytoplasm. Survival factor withdrawal induces dephosphorylation and promotes translocation to the nucleus where the dephosphorylated protein induces transcription of target genes and triggers apoptosis. Although AKT1/PKB doesn't appear to phosphorylate Ser-315 directly, it may activate other kinases that trigger phosphorylation at this residue. Phosphorylated by STK4/MST1 on Ser-209 upon oxidative stress, which leads to dissociation from YWHAB/14-3-3-beta and nuclear translocation. Phosphorylated by PIM1. Phosphorylation by AMPK leads to the activation of transcriptional activity without affecting subcellular localization. In response to metabolic stress, phosphorylated by AMPK on Ser-30 which mediates FOXO3 mitochondrial translocation. Phosphorylation by MAPKAPK5 promotes nuclear localization and DNA-binding, leading to induction of miR-34b and miR-34c expression, 2 post-transcriptional regulators of MYC that bind to the 3'UTR of MYC transcript and prevent its translation. Phosphorylated by CHUK/IKKA and IKBKB/IKKB. TNF-induced inactivation of FOXO3 requires its phosphorylation at Ser-644 by IKBKB/IKKB which promotes FOXO3 retention in the cytoplasm, polyubiquitination and ubiquitin-mediated proteasomal degradation. May be dephosphorylated by calcineurin A on Ser-299 which abolishes FOXO3 transcriptional activity (By similarity). In cancer cells, ERK mediated-phosphorylation of Ser-12 is required for mitochondrial translocation of FOXO3 in response to metabolic stress or chemotherapeutic agents.
Deacetylation by SIRT1 or SIRT2 stimulates interaction of FOXO3 with SKP2 and facilitates SCF(SKP2)-mediated FOXO3 ubiquitination and proteasomal degradation. Deacetylation by SIRT2 stimulates FOXO3-mediated transcriptional activity in response to oxidative stress (By similarity). Deacetylated by SIRT3. Deacetylation by SIRT3 stimulates FOXO3-mediated mtDNA transcriptional activity in response to metabolic stress.
Heavily methylated by SET9 which decreases stability, while moderately increasing transcriptional activity. The main methylation site is Lys-271. Methylation doesn't affect subcellular location.
Polyubiquitinated. Ubiquitinated by a SCF complex containing SKP2, leading to proteasomal degradation.
The N-terminus is cleaved following import into the mitochondrion.
Cytoplasm>Cytosol. Nucleus. Mitochondrion matrix. Mitochondrion outer membrane>Peripheral membrane protein>Cytoplasmic side.
Note: Retention in the cytoplasm contributes to its inactivation (PubMed:10102273, PubMed:15084260, PubMed:16751106). Translocates to the nucleus upon oxidative stress and in the absence of survival factors (PubMed:10102273, PubMed:16751106). Translocates from the cytosol to the nucleus following dephosphorylation in response to autophagy-inducing stimuli (By similarity). Translocates in a AMPK-dependent manner into the mitochondrion in response to metabolic stress (PubMed:23283301, PubMed:29445193).
Ubiquitous.
Upon metabolic stress, forms a complex composed of FOXO3, SIRT3 and mitochondrial RNA polymerase POLRMT; the complex is recruited to mtDNA in a SIRT3-dependent manner. Also forms a complex composed of FOXO3, SIRT3, TFAM and POLRMT. Interacts with SIRT2; the interaction occurs independently of SIRT2 deacetylase activity (By similarity). Interacts with YWHAB/14-3-3-beta and YWHAZ/14-3-3-zeta, which are required for cytosolic sequestration. Upon oxidative stress, interacts with STK4/MST1, which disrupts interaction with YWHAB/14-3-3-beta and leads to nuclear translocation. Interacts with PIM1. Interacts with DDIT3/CHOP. Interacts (deacetylated form) with SKP2. Interacts with CHUK and IKBKB. Interacts with CAMK2A, CAMK2B and calcineurin A (By similarity). Interacts FOXO3; this interaction represses FOXO3 transactivation.
Transcription factor involved in the regulation of the insulin signaling pathway. Binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. Down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. Also involved in negative regulation of the cell cycle. Involved in increased proteasome activity in embryonic stem cells (ESCs) by activating expression of PSMD11 in ESCs, leading to enhanced assembly of the 26S proteasome, followed by higher proteasome activity.
Acetylation by CREBBP/CBP, which is induced by peroxidase stress, inhibits transcriptional activity. Deacetylation by SIRT1 is NAD-dependent and stimulates transcriptional activity.
Phosphorylation by PKB/AKT1 inhibits transcriptional activity and is responsible for cytoplasmic localization. May be phosphorylated at multiple sites by NLK.
Monoubiquitinated; monoubiquitination is induced by oxidative stress and reduced by deacetylase inhibitors; results in its relocalization to the nucleus and its increased transcriptional activity. Deubiquitinated by USP7; deubiquitination is induced by oxidative stress; enhances its interaction with USP7 and consequently, deubiquitination; increases its translocation to the cytoplasm and inhibits its transcriptional activity. Hydrogene-peroxide-induced ubiquitination and USP7-mediated deubiquitination have no major effect on its protein stability.
Cytoplasm. Nucleus.
Note: When phosphorylated, translocated from nucleus to cytoplasm. Dephosphorylation triggers nuclear translocation. Monoubiquitination increases nuclear localization. When deubiquitinated, translocated from nucleus to cytoplasm.
Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Isoform zeta is most abundant in the liver, kidney, and pancreas.
Interacts with CREBBP/CBP, CTNNB1, MYOCD, SIRT1, SRF and YWHAZ. Acetylated by CREBBP/CBP and deacetylated by SIRT1. Binding of YWHAZ inhibits DNA-binding. Interacts with USP7; the interaction is enhanced in presence of hydrogen peroxide and occurs independently of TP53. Interacts with NLK, and this inhibits monoubiquitination and transcriptional activity. Interacts with FOXK1; the interaction inhibits MEF2C transactivation activity (By similarity).
Research Fields
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > AMPK signaling pathway. (View pathway)
· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.
· Human Diseases > Endocrine and metabolic diseases > Insulin resistance.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Cancers: Specific types > Endometrial cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Prostate cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Non-small cell lung cancer. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Aging > Longevity regulating pathway. (View pathway)
· Organismal Systems > Aging > Longevity regulating pathway - multiple species. (View pathway)
· Organismal Systems > Nervous system > Neurotrophin signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Insulin signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Prolactin signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Glucagon signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.