Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    Phospho-PAK3 (Ser154) Antibody
  • Catalog No.
    AF0046
  • RRID
    AB_2834092
  • Source
    Rabbit
  • Application
    WB,IHC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
  • UniProt
  • Mol.Wt
    72kD;
    62kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Alpha PAK; Beta PAK; bPAK; CDKN1A; Gamma PAK; hPAK3; MRX30; MRX47; Oligophrenin 3; OPHN3; P21 (CDKN1A) activated kinase 2; P21 (CDKN1A) activated kinase 3; p21 activated kinase 1; p21 activated kinase 2; p21 activated kinase 3; P21 protein (Cdc42/Rac) activated kinase 1; P21 protein (Cdc42/Rac) activated kinase 2; P21 protein (Cdc42/Rac) activated kinase 3; P21/Cdc42/Rac1 activated kinase 1 (STE20 homolog, yeast); P21/Cdc42/Rac1 activated kinase 1 (yeast Ste20 related); P58; P65 PAK; PAK 2; PAK 3; PAK1; PAK2; PAK3; PAK3beta; PAK65; PAKalpha; PAKgamma; S6/H4 kinase; Serine/threonine protein kinase PAK 1; Serine/threonine protein kinase PAK 2; Serine/threonine protein kinase PAK 3; Serine/threonine protein kinase PAK1; Serine/threonine protein kinase PAK2; Serine/threonine protein kinase PAK3; STE20 homolog, yeast;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Specificity:

Phospho-PAK3 (Ser154) Antibody detects endogenous levels of PAK3 only when phosphorylated at Sersine 154.

RRID:

AB_2834092
Please cite this product as: Affinity Biosciences Cat# AF0046, RRID:AB_2834092.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human PAK3 around the phosphorylation site of Ser154.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

PAK3

Molecular Weight:

Observed Mol.Wt.: 72kD.
Predicted Mol.Wt.: 62kDa(Calculated)..

Subcellular Location:

Cytoplasm. Recruited to focal adhesions upon activation

Tissue Specificity:

O75914 PAK3_HUMAN:
Restricted to the nervous system. Highly expressed in postmitotic neurons of the developing and postnatal cerebral cortex and hippocampus.

Description:

PAK3 a protein kinase of the STE20 family that regulates synapse formation and plasticity in the hippocampus. May be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Forms an activated complex with GTP-bound P21, CDC2 and RAC1 proteins. Missense and truncation mutations linked to nonsyndromic mental retardation type 30 (MRX30). Two alternatively spliced human isoforms have been reported. Note: This description may include information from UniProtKB.

Sequence:
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR

Research Background

Function:

Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, or cell cycle regulation. Plays a role in dendrite spine morphogenesis as well as synapse formation and plasticity. Acts as downstream effector of the small GTPases CDC42 and RAC1. Activation by the binding of active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates MAPK4 and MAPK6 and activates the downstream target MAPKAPK5, a regulator of F-actin polymerization and cell migration. Additionally, phosphorylates TNNI3/troponin I to modulate calcium sensitivity and relaxation kinetics of thin myofilaments. May also be involved in early neuronal development.

Post-translational Modifications:

Autophosphorylated when activated by CDC42/p21.

Neddylated.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Restricted to the nervous system. Highly expressed in postmitotic neurons of the developing and postnatal cerebral cortex and hippocampus.

Subunit Structure:

Interacts tightly with GTP-bound but not GDP-bound CDC42/p21 and RAC1. Shows highly specific binding to the SH3 domains of phospholipase C-gamma and of adapter protein NCK. Interacts with the C-terminal of APP (By similarity). Interacts with ARHGEF6 and ARHGEF7.

Similarity:

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.

Research Fields

Research Fields:

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.(View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.(View pathway)
· Environmental Information Processing > Signal transduction > ErbB signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway.(View pathway)
· Human Diseases > Cancers: Specific types > Renal cell carcinoma.(View pathway)
· Organismal Systems > Development > Axon guidance.(View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway.(View pathway)

WB Images(1)


IHC Images(1)


ELISA analysis of AF0046 showing specificity to Phospho-PAK3 (Ser154) Blocking Peptide peptide. Peptides concentration: 1ug/ml.
P-peptide: phospho-peptide; N-peptide: non-phospho-peptide.
No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF0046-BP
(Blocking peptide available as AF0046-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Horse
100%
Bovine
100%
Sheep
100%
Dog
100%
Xenopus
100%
Chicken
100%
Rabbit
100%
Pig
0%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
O75914 as Substrate
Site PTM Type Enzyme
S2 Phosphorylation
S50 Phosphorylation
K58 Ubiquitination
T59 Phosphorylation
K62 Ubiquitination
K124 Ubiquitination
S154 Phosphorylation
S186 Phosphorylation
Y217 Phosphorylation
T218 Phosphorylation
S220 Phosphorylation
K257 Acetylation
S259 Phosphorylation
K269 Acetylation
S272 Phosphorylation
S275 Phosphorylation
Y298 Phosphorylation
K322 Ubiquitination
K404 Ubiquitination
T428 Phosphorylation
K433 Acetylation
K433 Ubiquitination
S435 Phosphorylation
T436 Phosphorylation
T440 Phosphorylation
Y477 Phosphorylation
S524 Phosphorylation
K526 Ubiquitination
K535 Acetylation
K535 Ubiquitination
S558 Phosphorylation
O75914 as PTM Enzyme
Substrate Site Source
O75914-2 (PAK3) S139 Uniprot
O75914-2 (PAK3) T421 Uniprot
P04049 (RAF1) S338 Uniprot
P04049 (RAF1) S339 Uniprot
P17600-1 (SYN1) S605 Uniprot
P19429 (TNNI3) S150 Uniprot
Q02750 (MAP2K1) S298 Uniprot
Q05682 (CALD1) S714 Uniprot
Q05682 (CALD1) S744 Uniprot
Q16659 (MAPK6) S189 Uniprot
Q9UM54-1 (MYO6) T405 Uniprot
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top