ZNF174 Antibody - #AF0633
| Product: | ZNF174 Antibody |
| Catalog: | AF0633 |
| Description: | Rabbit polyclonal antibody to ZNF174 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 46kDa; 46kD(Calculated). |
| Uniprot: | Q15697 |
| RRID: | AB_2834262 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0633, RRID:AB_2834262.
Fold/Unfold
AW-1; AW1; Zinc finger and SCAN domain containing protein 8; Zinc finger and SCAN domain-containing protein 8; Zinc finger protein 174; ZN174_HUMAN; ZNF174; ZSCAN8;
Immunogens
Expressed in a variety of organs, but most strongly in adult testis and ovary followed by small intestine, colon, prostate, thymus, spleen, pancreas, skeletal muscle, heart, brain and kidney. Also expressed in umbilical vein endothelial cells, foreskin fibroblast and Hep-G2 cells.
- Q15697 ZN174_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTEAPRMRSDNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVSSPNAQKPFAHYQRHCRVEYISSPLKSHPLRELKKSKGGKRSLSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTGERPYTCGECGNCFGRQSTLKLHQRIHTGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q15697 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K26 | Ubiquitination | Uniprot | |
| T149 | Phosphorylation | Uniprot | |
| T165 | Phosphorylation | Uniprot | |
| S174 | Phosphorylation | Uniprot | |
| S188 | Phosphorylation | Uniprot | |
| S195 | Phosphorylation | Uniprot | |
| T202 | Phosphorylation | Uniprot | |
| K204 | Sumoylation | Uniprot | |
| S215 | Phosphorylation | Uniprot | |
| S266 | Phosphorylation | Uniprot | |
| S287 | Phosphorylation | Uniprot | |
| T349 | Phosphorylation | Uniprot | |
| S367 | Phosphorylation | Uniprot | |
| T368 | Phosphorylation | Uniprot | |
| T377 | Phosphorylation | Uniprot | |
| Y382 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional repressor.
Nucleus.
Expressed in a variety of organs, but most strongly in adult testis and ovary followed by small intestine, colon, prostate, thymus, spleen, pancreas, skeletal muscle, heart, brain and kidney. Also expressed in umbilical vein endothelial cells, foreskin fibroblast and Hep-G2 cells.
Homodimer.
Belongs to the krueppel C2H2-type zinc-finger protein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.