Product: IRX2 Antibody
Catalog: AF0552
Description: Rabbit polyclonal antibody to IRX2
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Horse, Rabbit, Dog
Mol.Wt.: 50kDa; 49kD(Calculated).
Uniprot: Q9BZI1
RRID: AB_2834315

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Horse(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
IRX2 Antibody detects endogenous levels of total IRX2.
RRID:
AB_2834315
Cite Format: Affinity Biosciences Cat# AF0552, RRID:AB_2834315.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Homeodomain protein IRXA2; Iroquois homeobox 2; Iroquois homeobox protein 2; Iroquois-class homeodomain protein irx-2; IRX 2; irx2; IRX2_HUMAN; IrxA2;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
IRX1 is a member of the Iroquois homeobox gene family. Members of this family appear to play multiple roles during pattern formation of vertebrate embryos.
Sequence:
MSYPQGYLYQAPGSLALYSCPAYGASALAAPRSEELARSASGSAFSPYPGSAAFTAQAATGFGSPLQYSADAAAAAAGFPSYMGAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDEDEGDATRSKDESPDKAQEGTETSAEDEGISLHVDSLTDHSCSAESDGEKLPCRAGDPLCESGSECKDKYDDLEDDEDDDEEGERGLAPPKPVTSSPLTGLEAPLLSPPPEAAPRGGRKTPQGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCGPPGLPAAAAPASTGAPPGGSPYPASPLLGRPLYYTSPFYGNYTNYGNLNAALQGQGLLRYNSAAAAPGEALHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Dog
100
Rabbit
100
Chicken
67
Bovine
0
Sheep
0
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q9BZI1 As Substrate

Site PTM Type Enzyme
S46 Phosphorylation P28482 (MAPK1)
S64 Phosphorylation P28482 (MAPK1)
S186 Phosphorylation
S231 Phosphorylation
S233 Phosphorylation
S236 Phosphorylation
S252 Phosphorylation
S254 Phosphorylation
T310 Phosphorylation
S317 Phosphorylation P27361 (MAPK3)
S325 Phosphorylation
S338 Phosphorylation

Research Backgrounds

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the TALE/IRO homeobox family.

References

1). IRX2 regulates angiotensin II-induced cardiac fibrosis by transcriptionally activating EGR1 in male mice. Nature Communications (PubMed: 37587150) [IF=16.6]

Application: WB    Species: Mouse    Sample: cardiac fibroblasts

Fig. 1 IRX2 expression was increased in fibrotic hearts. A Relative mRNA levels of 6 Irx family members in adult mouse cardiac fibroblasts (CFs) after angiotensin II (Ang II) treatment for 24 h (n = 5). B Relative mRNA levels of 6 IRX family members in human CFs after Ang II treatment for 24 h (n = 5). C Irx2 mRNA levels in the heart after Ang II infusion by an osmotic minipump (n = 6). D Representative western blots and statistical analysis of IRX2 expression in the heart after Ang II infusion for 12 weeks (n = 6). E Representative western blots and statistical analysis of IRX2 expression in heart samples obtained from patients with dilated cardiomyopathy (DCM) and control (Con) donors (Con, n = 6; DCM, n = 7). F Irx2 mRNA levels in endothelial cells (ECs), cardiomyocytes (CMs) and CFs isolated from hearts infused with Ang II for 12 weeks (n = 6). G Representative western blots and quantification of IRX2 protein expression in CFs isolated from hearts infused with Ang II for 12 weeks (n = 6). Data are shown as the mean ± SEM, and analysed using an unpaired two-tailed Student′s t test. For the analysis in (C), one-way ANOVA with Tamhane’s T2 test was conducted. Source data are provided as a Source Data file.

Application: IF/ICC    Species: Mouse    Sample: cardiac fibroblasts

Fig. 2 Conditional fibroblast-specific Irx2-deficient mice exhibited attenuated fibrotic remodelling in response to angiotensin II (Ang II) infusion. A Conditional fibroblast-specific Irx2-deficient mice (Irx2 cfKO) were bred by crossing mice with a conditional knockout allele of Irx2 (Irx2fl/fl) with Col1α2-Cre mice. Irx2 cfKO mice and littermate controls were subjected to Ang II infusion for 12 weeks. B Representative western blots and statistical analysis of IRX2 protein expression in CFs isolated from Irx2 cfKO mice and littermate controls (n = 5). C–E Irx2 cfKO mice exhibited an attenuated heart weight-to-tibia length (HW/TL) ratio (n = 10 mice, Col1α2-Cre+Saline; n = 12 mice, Irx2fl/fl+Saline; n = 12 mice, Irx2 cfKO+Saline; n = 12 mice, Col1α2-Cre+Ang II; n = 11 mice, Irx2fl/fl+Ang II; n = 12 mice, Irx2 cfKO+Ang II) (C), a reduced fibrosis area (n = 5) (D), and a decreased cell area of cardiomyocytes (n = 5) (E) after Ang II infusion. F Relative mRNA levels of Col1 and Col3 in hearts from Irx2 cfKO mice and littermate controls after Ang II infusion (n = 6). G Cardiac function (n = 6) was improved in Ang II-infused Irx2 cfKO mice. Data are shown as the mean ± SEM, and analysed using one-way ANOVA followed by Tukey post hoc test (E and G) or Tamhane’s T2 test (C, D and F). For the analysis in (B), an unpaired two-tailed Student′s t test was conducted. Source data are provided as a Source Data file.

Application: IHC    Species: Mouse    Sample: cardiac fibroblasts

Fig. 2 Conditional fibroblast-specific Irx2-deficient mice exhibited attenuated fibrotic remodelling in response to angiotensin II (Ang II) infusion. A Conditional fibroblast-specific Irx2-deficient mice (Irx2 cfKO) were bred by crossing mice with a conditional knockout allele of Irx2 (Irx2fl/fl) with Col1α2-Cre mice. Irx2 cfKO mice and littermate controls were subjected to Ang II infusion for 12 weeks. B Representative western blots and statistical analysis of IRX2 protein expression in CFs isolated from Irx2 cfKO mice and littermate controls (n = 5). C–E Irx2 cfKO mice exhibited an attenuated heart weight-to-tibia length (HW/TL) ratio (n = 10 mice, Col1α2-Cre+Saline; n = 12 mice, Irx2fl/fl+Saline; n = 12 mice, Irx2 cfKO+Saline; n = 12 mice, Col1α2-Cre+Ang II; n = 11 mice, Irx2fl/fl+Ang II; n = 12 mice, Irx2 cfKO+Ang II) (C), a reduced fibrosis area (n = 5) (D), and a decreased cell area of cardiomyocytes (n = 5) (E) after Ang II infusion. F Relative mRNA levels of Col1 and Col3 in hearts from Irx2 cfKO mice and littermate controls after Ang II infusion (n = 6). G Cardiac function (n = 6) was improved in Ang II-infused Irx2 cfKO mice. Data are shown as the mean ± SEM, and analysed using one-way ANOVA followed by Tukey post hoc test (E and G) or Tamhane’s T2 test (C, D and F). For the analysis in (B), an unpaired two-tailed Student′s t test was conducted. Source data are provided as a Source Data file.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.