Collagen XIII alpha 1 Antibody - #AF0598

(2)   (2)  
Product: Collagen XIII alpha 1 Antibody
Catalog: AF0598
Description: Rabbit polyclonal antibody to Collagen XIII alpha 1
Application: WB IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse
Prediction: Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 70kDa; 70kD(Calculated).
Uniprot: Q5TAT6
RRID: AB_2834323

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Bovine(100%), Horse(100%), Sheep(100%), Rabbit(91%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Collagen XIII alpha 1 Antibody detects endogenous levels of total Collagen XIII alpha 1.
RRID:
AB_2834323
Cite Format: Affinity Biosciences Cat# AF0598, RRID:AB_2834323.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CODA1_HUMAN;COL13A1;collagen type XIII alpha 1;collagen alpha 1(XIII) chain;Collagen alpha-1(XIII) chain;COLXIIIA1;

Immunogens

Immunogen:

A synthesized peptide derived from human Collagen XIII alpha 1, corresponding to a region within C-terminal amino acids.

Uniprot:

Q5TAT6(CODA1_HUMAN) >>Visit HPA database.

Gene(ID):
COL13A1(1305)
Expression:
Q5TAT6 CODA1_HUMAN:

Widely expressed in both fetal and adult ocular tissues (at protein level). In the eye, expression is accentuated in the ciliary muscle, optic nerve and the neural retina. In early placenta, localized to fibroblastoid stromal cells of the placental villi, to endothelial cells of developing capillaries and to cells of the cytotrophoblastic columns. Also detected in large decidual cells of the decidual membrane and to stromal cells of the gestational endometrium, but not in the epithelial cells in the endometrial glands. Isoform 10: Expressed in muscle (PubMed:26626625).

Description:
This gene encodes the alpha chain of one of the nonfibrillar collagens. The function of this gene product is not known, however, it has been detected at low levels in all connective tissue-producing cells so it may serve a general function in connective tissues. Unlike most of the collagens, which are secreted into the extracellular matrix, collagen XIII contains a transmembrane domain and the protein has been localized to the plasma membrane. The transcripts for this gene undergo complex and extensive splicing involving at least eight exons. Like other collagens, collagen XIII is a trimer; it is not known whether this trimer is composed of one or more than one alpha chain isomer. A number of alternatively spliced transcript variants have been described, but the full length nature of some of them has not been determined.
Sequence:
MVAERTHKAAATGARGPGELGAPGTVALVAARAERGARLPSPGSCGLLTLALCSLALSLLAHFRTAELQARVLRLEAERGEQQMETAILGRVNQLLDEKWKLHSRRRREAPKTSPGCNCPPGPPGPTGRPGLPGDKGAIGMPGRVGSPGDAGLSIIGPRGPPGQPGTRGFPGFPGPIGLDGKPGHPGPKGDMGLTGPPGQPGPQGQKGEKGQCGEYPHRECLSSMPAALRSSQIIALKLLPLLNSVRLAPPPVIKRRTFQGEQSQASIQGPPGPPGPPGPSGPLGHPGLPGPMGPPGLPGPPGPKGDPGIQGYHGRKGERGMPGMPGKHGAKGAPGIAVAGMKGEPGIPGTKGEKGAEGSPGLPGLLGQKGEKGDAGNSIGGGRGEPGPPGLPGPPGPKGEAGVDGQVGPPGQPGDKGERGAAGEQGPDGPKGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLPGQIGPPGAPGIPGQKGEIGLPGPPGHDGEKGPRGKPGDMGPPGPQGPPGKDGPPGVKGENGHPGSPGEKGEKGETGQAGSPGEKGEAGEKGNPGAEVPGLPGPEGPPGPPGLQGVPGPKGEAGLDGAKGEKGFQGEKGDRGPLGLPGASGLDGRPGPPGTPGPIGVPGPAGPKGERGSKGDPGMTGPTGAAGLPGLHGPPGDKGNRGERGKKGSRGPKGDKGDQGAPGLDAPCPLGEDGLPVQGCWNK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
91
Pig
60
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Involved in cell-matrix and cell-cell adhesion interactions that are required for normal development. May participate in the linkage between muscle fiber and basement membrane. May play a role in endochondral ossification of bone and branching morphogenesis of lung. Binds heparin. At neuromuscular junctions, may play a role in acetylcholine receptor clustering.

Subcellular Location:

Cell membrane>Single-pass type II membrane protein. Cell junction>Synapse>Postsynaptic cell membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed in both fetal and adult ocular tissues (at protein level). In the eye, expression is accentuated in the ciliary muscle, optic nerve and the neural retina. In early placenta, localized to fibroblastoid stromal cells of the placental villi, to endothelial cells of developing capillaries and to cells of the cytotrophoblastic columns. Also detected in large decidual cells of the decidual membrane and to stromal cells of the gestational endometrium, but not in the epithelial cells in the endometrial glands. Isoform 10: Expressed in muscle.

Research Fields

· Organismal Systems > Digestive system > Protein digestion and absorption.

References

1). Merlin controls limb development and thumb formation by regulating primary cilium-hedgehog signaling. Cell reports, 2025 (PubMed: 40503937) [IF=7.5]

Application: IHC    Species: Mouse    Sample:

Figure 2 Merlin deficiency impairs chondrocyte proliferation and hypertrophy (A) EdU incorporation and staining in E18.5 Nf2f/f and Nf2f/f;Prx1-Cre mouse tibial growth plates to assess chondrocyte proliferation. (B and C) Quantification of the percentage of EdU+ (proliferating) cells in the resting zone (B) and proliferative zone (C) in (A). (D and E) Ki67 IF in primary chondrocytes (D) and quantification (E). (F) CCK8 assay for cell proliferation. (G–I) IHC for COL10 and MMP13 (G) and quantification of positive area/intensity (H–I). (J and K) Alkaline phosphatase (ALP) and Alizarin red staining of differentiated chondrocytes (J) and quantification (K). (L) RT-qPCR for Mmp13, Col10, Runx2, and Opn, normalized to Hprt1. (M) Western blot for OPN, RUNX2, and MMP13; β-actin was the loading control. (N and O) TUNEL staining in hypertrophic zones (N) and quantification of apoptotic chondrocytes (O). EdU, 5-ethynyl-2′-deoxyuridine; TUNEL, terminal deoxynucleotidyl transferase (TdT) dUTP nick-end labeling. Scale bars, 20 μm (D), 50 μm (N), 100 μm (A and G), and 1 mm (J). Quantification data are presented as mean ± SD; p values (t test) are indicated between the bars. n≥ 4 (A–C), n = 7 (D and E), n = 3 (F), n≥ 3 (G–I), n = 8–13 (J–L), n ≥ 4 (M), and n = 8 (N and O) per group.

Application: WB    Species: Mouse    Sample:

Figure 1 Merlin is expressed during limb development, and its deficiency causes limb dysplasia (A and B) In situ hybridization (ISH) showing Nf2/Merlin expression in limb buds at embryonic day 10.5 (E10.5)–E14.5. (C) Immunohistochemistry (IHC) of Merlin in E18.5 tibial growth plates, with enlarged views of proliferative (top) and hypertrophic (bottom) zones. Scale bars, 100 μm. (D) Western blot of COL10, MMP13, OPN, and Merlin in primary chondrocytes during hypertrophic differentiation; β-actin was the loading control. (E) Representative images of Nf2f/f and Nf2f/f;Prx1-Cre mice. (F and G) RT-qPCR of Nf2 expression in cartilage (F) and primary chondrocytes (G) from Nf2f/f;Prx1-Cre versus controls. Nf2 mRNA levels were normalized to Hprt1. (H–J) Whole-mount alizarin red-Alcian blue skeletal staining of E18.5 embryos, showing the whole body (H), limbs (I), and autopods (J). Quantification data are presented as mean ± SD; p values (t test) are indicated between bars. Data represent n = 3 (A-E), n ≥ 4 (H-J), n = 6 (F) and n = 4 (G) per group.
2). Koumine alters immune barrier function by targeting TGFβ-mediated collagen deposition in gastric cancer. European journal of pharmacology, 2025 (PubMed: 40675356) [IF=4.2]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.