Product: Phospho-YAP (Ser127) Antibody
Catalog: AF3328
Description: Rabbit polyclonal antibody to Phospho-YAP (Ser127)
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Zebrafish, Horse, Sheep, Rabbit, Chicken, Xenopus
Mol.Wt.: 65~78kD; 54kD(Calculated).
Uniprot: P46937
RRID: AB_2810276

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Prediction:
Pig(100%), Zebrafish(100%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
Phospho-YAP (Ser127) Antibody detects endogenous levels of YAP only when phosphorylated at Serine 127.
RRID:
AB_2810276
Cite Format: Affinity Biosciences Cat# AF3328, RRID:AB_2810276.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

65 kDa Yes associated protein; 65 kDa Yes-associated protein; COB1; YAp 1; YAP 65; YAP; YAP1; YAP1_HUMAN; YAP2; YAP65; yes -associated protein delta; Yes associated protein 1 65kDa; Yes associated protein 1; Yes associated protein 2; yes associated protein beta; YKI; Yorkie homolog;

Immunogens

Immunogen:

A synthesized peptide derived from human YAP around the phosphorylation site of Ser127.

Uniprot:
Gene(ID):
Expression:
P46937 YAP1_HUMAN:

Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).

Description:
This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction.
Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Sheep
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
100
Bovine
0
Dog
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. Acts via ARHGAP18, a Rho GTPase activating protein that suppresses F-actin polymerization. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction.

Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).

PTMs:

Phosphorylated by LATS1 and LATS2; leading to cytoplasmic translocation and inactivation. Phosphorylated by ABL1; leading to YAP1 stabilization, enhanced interaction with TP73 and recruitment onto proapoptotic genes; in response to DNA damage. Phosphorylation at Ser-400 and Ser-403 by CK1 is triggered by previous phosphorylation at Ser-397 by LATS proteins and leads to YAP1 ubiquitination by SCF(beta-TRCP) E3 ubiquitin ligase and subsequent degradation. Phosphorylated at Thr-119, Ser-138, Thr-154, Ser-367 and Thr-412 by MAPK8/JNK1 and MAPK9/JNK2, which is required for the regulation of apoptosis by YAP1.

Ubiquitinated by SCF(beta-TRCP) E3 ubiquitin ligase.

Subcellular Location:

Cytoplasm. Nucleus.
Note: Both phosphorylation and cell density can regulate its subcellular localization. Phosphorylation sequesters it in the cytoplasm by inhibiting its translocation into the nucleus. At low density, predominantly nuclear and is translocated to the cytoplasm at high density (PubMed:18158288, PubMed:20048001). PTPN14 induces translocation from the nucleus to the cytoplasm (PubMed:22525271).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).

Family&Domains:

The first coiled-coil region mediates most of the interaction with TEAD transcription factors.

Belongs to the YAP1 family.

Research Fields

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway - multiple species.   (View pathway)

References

1). 3D-bioprinted GelMA nerve guidance conduits promoted peripheral nerve regeneration by inducing trans-differentiation of MSCs into SCLCs via PIEZO1/YAP axis. Materials Today Advances, 2023 [IF=8.1]

Application: WB    Species: Rat    Sample: MSCs

Fig. 4. The correlation between trans-differentiation and PIEZO1/YAP expression in MSCs. (A) Representative immunofluorescent images for the subcellular localization and activating states of YAP/TAZ in MSCs plating on GelMA and hard substrate (HS) before trans-differentiation. Scale bar:100 μm. (B) Representative immunofluorescent images for the activating states of YAP/TAZ and expression of S100β in GelMA and HS groups after trans-differentiation. Scale bar:100 μm. (C) Representative immunofluorescent images for the subcellular localization and activating states of YAP/TAZ and PIEZO1 in MSCs after trans-differentiation. Scale bar:10 μm. (D) Immunoblotted image for PIEZO2, PIEZO1, YAP/TAZ, p-YAP, GFAP, NGF, S100β in MSCs plating on GelMA and HS after co-culture with Ne–4C. (E) Densitometric analysis of blots showing the values of relevant proteins in GelMA and HS groups. (F) Immunoblotted image for PIEZO1, YAP/TAZ, p-YAP and GFAP in MSCs in co-culture system, after being treated with Yoda1 and GsMTx4. (G) Densitometric analysis of blots showing the values of relevant proteins in MSCs after being treated with Yoda1 and GsMTx4. (H) An indirect co-culture system including NE-4C in the upper chamber and MSCs plated on GelMA in the lower chambers.

2). Cyclovirobuxine D inhibits triple-negative breast cancer via YAP/TAZ suppression and activation of the FOXO3a/PINK1-Parkin pathway-induced mitophagy. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2025 (PubMed: 39615216) [IF=6.7]

3). Resveratrol Inhibits the Tumorigenesis of Follicular Thyroid Cancer via ST6GAL2-Regulated Activation of the Hippo Signaling Pathway. Molecular Therapy-Oncolytics, 2020 (PubMed: 32055676) [IF=5.3]

Application: WB    Species: human    Sample: FTC cells

Figure 4.| Upregulation of ST6GAL2 Rescues Tumorigenesis of FTC238 Cells and Resuppresses Hippo Signaling Pathway Activity(A–F) ST6GAL2 knockdown cells were transfected with ST6GAL2 overexpression vectors, and the proliferation,migration, and invasion capacities of FTC cells were enhanced. (G and H) Western blotting was performed to determine the levels of Hippo signaling molecules in FTC cells. *p < 0.05; scale bars, 20 mm.

4). A derivant of ginsenoside CK and its inhibitory effect on hepatocellular carcinoma. LIFE SCIENCES, 2022 (PubMed: 35690105) [IF=5.2]

5). Knockdown of HSP110 attenuates hypoxia-induced pulmonary hypertension in mice through suppression of YAP/TAZ-TEAD4 pathway. RESPIRATORY RESEARCH, 2022 (PubMed: 35986277) [IF=4.7]

Application: WB    Species: Mouse    Sample: lung tissues

Fig. 3Knockdown of HSP110 inhibits hypoxia-induced autophagy and YAP/TAZ-TEAD4 activity in mice. Relative mRNA level (a) and protein level (b, c) of HSP110 pulmonary arteries in lung tissues in each group (N = 8). d Double immunofluorescence staining of α-SMA (green) and HSP110 (red) in pulmonary arteries (N = 8). White scale bars, 50 μm; Yellow scale bars, 25 μm. White arrows pointed to α-SMA and HSP110 double-positive cells. e Protein levels of LC3II, LC3I, Beclin1, ATG5, ATG7 and p62 in pulmonary arteries (N = 8). f–h Quantitative analysis of relative protein ratio of LC3-II/I and relative protein level of Beclin1, p62, ATG5 and ATG7 (N = 8). i Double immunofluorescence staining of α-SMA (green) and Beclin 1 (red) in pulmonary arteries (N = 8). Scale bars, 50 μm. j Protein levels of p-YAP, YAP, p-TAZ and TAZ in pulmonary arteries (N = 8). k Quantitative analysis of relative protein ratio of p-YAP/t-YAP and p-TAZ/t-TAZ (N = 8). l–n Nuclear protein levels of YAP, TAZ and TEAD4 and quantitative analysis of relative protein level of nuclear YAP, TAZ and TEAD4 (N = 8). o Double immunofluorescence staining of α-SMA (green) and YAP (red) in pulmonary arteries (N = 8). White scale bars, 50 μm; Yellow scale bars, 25 μm. White arrows pointed to α-SMA and YAP double-positive cells. Data are means ± SD from 8 mice per group. *p 

6). Unveiling the mechanism of photothermal therapy in acne man-agement: targeting sebaceous gland ferroptosis via umbilical cord mesenchymal stem cell membrane-encapsulated Au-Ag-PDA. Frontiers in bioengineering and biotechnology, 2024 (PubMed: 38915336) [IF=4.3]

7). AT1R regulates macrophage polarization through YAP and regulates aortic dissection incidence. Frontiers in Physiology, 2021 (PubMed: 34305627) [IF=4.0]

Application: WB    Species: Mice    Sample: macrophages

FIGURE 6 Transfecting macrophages with a YAP siRNA further enhanced Ang II–induced macrophage M1 polarization and adhesion. (A) YAP siRNA efficiencies (n = 3, mean and S.D., t-test, &&P < 0.05 compared with siRNA NC;%%P < 0.05 compared with siRNA 860); (B,C) Western Blot of YAP after siRNA transfection *P < 0.05 compared with siRNA NC; (D) Flow cytometry analysis of CD68, CD86, and CD206 expression after 96 h co-culture in both groups. The data in the one-factor histogram represents the cells in the red circle in the upper scatter plot. HAECs + THP-1 + Ang II (1 μM, 24 h) + siRNA NC group: CD68, 41.94%; CD86, 45.73%; CD206, 9.72%. HAECs + THP-1 + Ang II + YAP siRNA group: CD68, 63.13%; CD86, 53.42%; CD206, 7.13%; (E–G) The proportion of CD68 +, CD86 +, and CD206 + cells, respectively (n = 3, mean and S.D., t-test, **P < 0.05 compared with the HAECs + THP-1 + siRNA NC group); (H) Fluorescence staining of adherent macrophages after YAP siRNA transfection. All cells were labeled with DAPI (blue), and the number of adherent macrophages was significantly decreased after transfection with the AT1R siRNA; (I) The ratio between the number of macrophages and the total number of cells (n = 3, mean and S.D., t-test, symbols are the same as in C,D,E).

8). Salvianolic acid B ameliorates atherosclerosis via inhibiting YAP/TAZ/JNK signaling pathway in endothelial cells and pericytes. BIOCHIMICA ET BIOPHYSICA ACTA-MOLECULAR AND CELL BIOLOGY OF LIPIDS, 2020 (PubMed: 32739616) [IF=3.9]

Application: WB    Species: mouse    Sample: ECs

Fig. 5.| Influence of Sal-B on inflammatory response during YAP/TAZ/JNK signaling pathway in ECs. (A) Expression levels of YAP, TAZ, JNK, NF-κB and TNF-α were monitored by RT-PCR (n = 3). (B–C, F) Proteins (YAP, p-YAP, TAZ, p-TAZ, JNK, Nuclear NF-κB P65, Total P65 and TNF-α) in the pathway were detected by western blot (n = 3).

9). Babaodan overcomes cisplatin resistance in cholangiocarcinoma via inhibiting YAP1. Pharmaceutical biology, 2024 (PubMed: 38571483) [IF=3.9]

Application: WB    Species: Human    Sample: CCAs

Figure 6. The extent of apoptosis, glutathione (GSH) synthesis, and the expression of DNA damage-related proteins were assessed in cholangiocarcinoma cells (CCAs) subjected to YAP1 knockdown or YAP1 overexpression. Western blot was used to measure protein levels (n = 3). With cisplatin incubation, YAP1 knockdown and 1 mg/mL babaodan (BBD) treatment decreased the (a) Bcl-2 level and (b) increased bax level, while the change in (c) cle-caspase-3/caspase-3 levels with BBD treatment was not statistically significant. In the CCAs dealing with cisplatin, the expression levels of (d) p-YAP1/YAP1, (e) ATF4, and (f) SLC1A5 were decreased by YAP1 knockdown and BBD treatment. Additionally, the (g) γH2Ax level was increased and (h) the ERCC1 level was inhibited by YAP1 knockdown and BBD treatment. YAP1 overexpression antagonized the effect of BBD on these proteins. Representative protein bands are shown in (i), (j), and (k). (mean ± standard deviation) +p 

10). Mechanical and signaling responses of unloaded rat soleus muscle to chronically elevated β-myosin activity. Archives of biochemistry and biophysics, 2024 (PubMed: 38492659) [IF=3.8]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.