ZNHIT1 Antibody - #DF10015
| Product: | ZNHIT1 Antibody |
| Catalog: | DF10015 |
| Description: | Rabbit polyclonal antibody to ZNHIT1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 18 kDa; 18kD(Calculated). |
| Uniprot: | O43257 |
| RRID: | AB_2840595 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10015, RRID:AB_2840595.
Fold/Unfold
CG1I; CGBP1; Cyclin G1 binding protein 1; p18 Hamlet; Zinc finger HIT domain containing protein 1; Zinc finger protein subfamily 4A member 1; zinc finger, HIT type 1; ZNFN4A1;
Immunogens
A synthesized peptide derived from human ZNHIT1, corresponding to a region within the internal amino acids.
Expressed abundantly in liver, but weakly in skeletal muscle, ovary and small intestine.
- O43257 ZNHI1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Seems to play a role in p53-mediated apoptosis induction. Binds to NR1D2 and relieves it of its inhibitory effect on the transcription of APOC3 without affecting its DNA-binding activity.
Phosphorylated on Thr by MAPK11 or MAPK14.
Stres-induced ZNHIT1 is mainly regulated at the level of protein.
Nucleus.
Expressed abundantly in liver, but weakly in skeletal muscle, ovary and small intestine.
Belongs to the ZNHIT1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.