CC50A Antibody - #DF10024
| Product: | CC50A Antibody |
| Catalog: | DF10024 |
| Description: | Rabbit polyclonal antibody to CC50A |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken |
| Mol.Wt.: | 41 kDa; 41kD(Calculated). |
| Uniprot: | Q9NV96 |
| RRID: | AB_2840604 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10024, RRID:AB_2840604.
Fold/Unfold
C6orf67; CDC50A; Cell cycle control protein 50A; FLJ10856; P4 ATPase flippase complex beta subunit TMEM30A; TMEM30A;
Immunogens
- Q9NV96 CC50A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NV96 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| Y5 | Phosphorylation | Uniprot | |
| K8 | Ubiquitination | Uniprot | |
| K24 | Ubiquitination | Uniprot | |
| K34 | Ubiquitination | Uniprot | |
| S89 | Phosphorylation | Uniprot | |
| K155 | Ubiquitination | Uniprot | |
| N190 | N-Glycosylation | Uniprot | |
| K202 | Ubiquitination | Uniprot | |
| K210 | Ubiquitination | Uniprot | |
| K213 | Ubiquitination | Uniprot | |
| K228 | Ubiquitination | Uniprot | |
| K232 | Ubiquitination | Uniprot | |
| K279 | Ubiquitination | Uniprot | |
| T285 | O-Glycosylation | Uniprot | |
| N294 | N-Glycosylation | Uniprot | |
| S313 | Phosphorylation | Uniprot | |
| T360 | Phosphorylation | Uniprot |
Research Backgrounds
Accessory component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules. The beta subunit may assist in binding of the phospholipid substrate. Required for the proper folding, assembly and ER to Golgi exit of the ATP8A2:TMEM30A flippase complex. ATP8A2:TMEM30A may be involved in regulation of neurite outgrowth, and, reconstituted to liposomes, predomiminantly transports phosphatidylserine (PS) and to a lesser extent phosphatidylethanolamine (PE). The ATP8A1:TMEM30A flippase complex seems to play a role in regulation of cell migration probably involving flippase-mediated translocation of phosphatidylethanolamine (PE) at the plasma membrane. Required for the formation of the ATP8A2, ATP8B1 and ATP8B2 P-type ATPAse intermediate phosphoenzymes. Involved in uptake of platelet-activating factor (PAF), synthetic drug alkylphospholipid edelfosine, and, probably in association with ATP8B1, of perifosine. Also mediates the export of alpha subunits ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B and ATP11C from the ER to other membrane localizations.
N-glycosylated. Contains high mannose-type oligosaccharides (By similarity).
Membrane>Multi-pass membrane protein. Cell membrane. Golgi apparatus. Cytoplasmic vesicle>Secretory vesicle membrane. Apical cell membrane.
Component of various P4-ATPase flippase complexes which consists of a catalytic alpha subunit and an accessory beta subunit. The ATP8A2:TMEM30A flippase complex has been purified, and ATP8B1:TMEM30A and ATP8B2:TMEM30A flippase complexes have been shown to form intermediate phosphoenzymes in vitro. Interacts with alpha subunits ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP11A, ATP11B and ATP11C.
The N-terminal domain seems to play a role in the reaction cycle of the catalytic subunit such as ATP8A2.
Belongs to the CDC50/LEM3 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.