MAGEA8 Antibody - #DF10032
Product: | MAGEA8 Antibody |
Catalog: | DF10032 |
Description: | Rabbit polyclonal antibody to MAGEA8 |
Application: | WB IHC |
Reactivity: | Human |
Mol.Wt.: | 35 kDa; 35kD(Calculated). |
Uniprot: | P43361 |
RRID: | AB_2840612 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10032, RRID:AB_2840612.
Fold/Unfold
Cancer/testis antigen 1.8; cancer/testis antigen family 1, member 8; CT1.8; MAGA8_HUMAN; MAGE 8 antigen; MAGE-8 antigen; MAGE8 antigen; MAGEA8; Melanoma antigen family A 8; Melanoma associated antigen 8; Melanoma-associated antigen 8; MGC2182;
Immunogens
A synthesized peptide derived from human MAGEA8, corresponding to a region within C-terminal amino acids.
Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testis and placenta.
- P43361 MAGA8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV
Research Backgrounds
Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testis and placenta.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.