MAGB2 Antibody - #DF10035
| Product: | MAGB2 Antibody |
| Catalog: | DF10035 |
| Description: | Rabbit polyclonal antibody to MAGB2 |
| Application: | WB |
| Reactivity: | Human |
| Mol.Wt.: | 35 kDa; 35kD(Calculated). |
| Uniprot: | O15479 |
| RRID: | AB_2840615 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10035, RRID:AB_2840615.
Fold/Unfold
Cancer/testis antigen 3.2; Cancer/testis antigen family 3, member 2; CT3.2; DAM6; DSS AHC critical interval MAGE superfamily 6; DSS/AHC critical interval gene, from MAGE superfamily, 6; MAGE B2 antigen; MAGE XP 2; MAGE XP 2 antigen; Mage-b2; Mage-rs2; melanoma antigen family B, 2; Melanoma antigen, family B, 1; Melanoma associated antigen B2; MGC2643; MGC26438; Smage-2 protein; Smage2;
Immunogens
Expressed in testis and placenta, and in a significant fraction of tumors of various histologic types.
- O15479 MAGB2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV
PTMs - O15479 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S42 | Phosphorylation | Uniprot | |
| S44 | Phosphorylation | Uniprot | |
| S51 | Phosphorylation | Uniprot | |
| S53 | Phosphorylation | Uniprot | |
| S77 | Phosphorylation | Uniprot | |
| S78 | Phosphorylation | Uniprot | |
| K80 | Ubiquitination | Uniprot | |
| S81 | Phosphorylation | Uniprot | |
| K92 | Ubiquitination | Uniprot | |
| S95 | Phosphorylation | Uniprot | |
| K104 | Ubiquitination | Uniprot | |
| S105 | Phosphorylation | Uniprot | |
| K114 | Ubiquitination | Uniprot | |
| S117 | Phosphorylation | Uniprot | |
| Y124 | Phosphorylation | Uniprot | |
| S131 | Phosphorylation | Uniprot | |
| K134 | Ubiquitination | Uniprot | |
| K139 | Ubiquitination | Uniprot | |
| K154 | Ubiquitination | Uniprot | |
| K250 | Ubiquitination | Uniprot | |
| K256 | Ubiquitination | Uniprot | |
| K261 | Ubiquitination | Uniprot | |
| K285 | Ubiquitination | Uniprot | |
| K287 | Ubiquitination | Uniprot | |
| K294 | Ubiquitination | Uniprot | |
| K312 | Acetylation | Uniprot | |
| K312 | Ubiquitination | Uniprot | |
| K316 | Ubiquitination | Uniprot |
Research Backgrounds
May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex.
Expressed in testis and placenta, and in a significant fraction of tumors of various histologic types.
Interacts with TRIM28.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.