DMRTC2 Antibody - #DF10062
Product: | DMRTC2 Antibody |
Catalog: | DF10062 |
Description: | Rabbit polyclonal antibody to DMRTC2 |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 93kDa; 39kD(Calculated). |
Uniprot: | Q8IXT2 |
RRID: | AB_2840642 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10062, RRID:AB_2840642.
Fold/Unfold
4933432E21Rik; DMRT like family C2; DMRT-like family C2; Dmrt7; Dmrtc2; Dmrtc2 doublesex and mab-3 related transcription factor like family C2; DMRTD_HUMAN; Doublesex and mab 3 related transcription factor 7; Doublesex and mab 3 related transcription factor C2; Doublesex and mab-3 related transcription factor like family C2; Doublesex- and mab-3-related transcription factor 7; Doublesex- and mab-3-related transcription factor C2;
Immunogens
A synthesized peptide derived from human DMRTC2, corresponding to a region within N-terminal amino acids.
- Q8IXT2 DMRTD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQVPSGKENIAPQPQTPHGAVLLAPTPPGKNSCGPLLLSHPPEASPLSWTPVPPGPWVPGHWLPPGFSMPPPVVCRLLYQEPAVSLPPFPGFDPGTSLQLPTHGPFTTCPGSHPVLTAPLSGEPQGPPSQPRTHSTLILQPCGTPDPLQLQPQASGASCLARTSGPSEWQLQQEAAEALVGLKDSSQAPRVTPSVPPNPAWISLLHPCGPPAPAGGRGFQPVGPCLRPSPAPSVALHIGRLGSISLLS
Research Backgrounds
May be involved in sexual development.
Nucleus.
Expressed in testis and pancreas.
Belongs to the DMRT family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.