MYCBP Antibody - #DF10076
| Product: | MYCBP Antibody |
| Catalog: | DF10076 |
| Description: | Rabbit polyclonal antibody to MYCBP |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Bovine, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 12 kDa; 12kD(Calculated). |
| Uniprot: | Q99417 |
| RRID: | AB_2840656 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10076, RRID:AB_2840656.
Fold/Unfold
AMY 1; AMY-1; AMY1; Associate of Myc 1; C myc binding protein; C-Myc-binding protein; Cmyc binding protein; MYCBP; MYCBP_HUMAN;
Immunogens
A synthesized peptide derived from human MYCBP, corresponding to a region within N-terminal amino acids.
Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.
- Q99417 MYCBP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.
Cytoplasm. Nucleus. Mitochondrion.
Note: Translocates into the nucleus in the S phase of the cell cycle upon an increase of MYC expression. Found in the mitochondria when associated with AKAP1.
Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.
Belongs to the AMY1 family.
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.