Product: IL22RA2 Antibody
Catalog: DF10107
Description: Rabbit polyclonal antibody to IL22RA2
Application: WB IF/ICC
Reactivity: Human
Mol.Wt.: 31 kDa; 31kD(Calculated).
Uniprot: Q969J5
RRID: AB_2840687

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
IL22RA2 Antibody detects endogenous levels of total IL22RA2.
RRID:
AB_2840687
Cite Format: Affinity Biosciences Cat# DF10107, RRID:AB_2840687.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

IL 22BP; IL 22RA2; IL22RA2; Class II cytokine receptor; CRF2 10; CRF2 S1; CRF2-10; CRF2-S1; CRF2X; Cytokine receptor class II member 10; Cytokine receptor class-II member 10; Cytokine receptor family 2 member 10; Cytokine receptor family type 2; Cytokine receptor family type 2 soluble 1; I22R2_HUMAN; IL 22 receptor subunit alpha 2; IL 22R alpha 2; IL-22 receptor subunit alpha-2; IL-22BP; IL-22R-alpha-2; IL-22RA2; IL22BP; IL22R alpha 2; Il22ra2; Interleukin 22 binding protein; Interleukin 22 Receptor alpha 2; Interleukin-22 receptor subunit alpha-2; Interleukin-22-binding protein; MGC150509; MGC150510; soluble 1; ZcytoR16;

Immunogens

Immunogen:

A synthesized peptide derived from human IL22RA2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q969J5 I22R2_HUMAN:

Expressed in placenta, spleen, breast, skin and lung. Also detected in intestinal tract, testis, brain, heart and thymus. No expression found in prostate, bladder, kidney, ovary, muscle, bone marrow, liver and uterus. Isoform 1 is expressed only in placenta. Isoform 2 is expressed in placenta and breast and at lower level in spleen, skin, thymus and stomach.

Sequence:
MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP

Research Backgrounds

Function:

Isoform 2 is a receptor for IL22. Binds to IL22, prevents interaction with the functional IL-22R complex and blocks the activity of IL22 (in vitro). May play an important role as an IL22 antagonist in the regulation of inflammatory responses.

Isoform 1 may play a role in establishing and maintaining successful pregnancy.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in placenta, spleen, breast, skin and lung. Also detected in intestinal tract, testis, brain, heart and thymus. No expression found in prostate, bladder, kidney, ovary, muscle, bone marrow, liver and uterus. Isoform 1 is expressed only in placenta. Isoform 2 is expressed in placenta and breast and at lower level in spleen, skin, thymus and stomach.

Family&Domains:

Belongs to the type II cytokine receptor family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.