IL1F9 Antibody - #DF10113

Product: | IL1F9 Antibody |
Catalog: | DF10113 |
Description: | Rabbit polyclonal antibody to IL1F9 |
Application: | WB IHC |
Cited expt.: | WB, IHC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 19 kDa; 19kD(Calculated). |
Uniprot: | Q9NZH8 |
RRID: | AB_2840693 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10113, RRID:AB_2840693.
Fold/Unfold
IL 1 epsilon; IL 1 related protein 2; IL 1(EPSILON); IL 1F9; IL 1H1; IL 1RP2; IL-1 epsilon; IL-1-related protein 2; IL-1F9; IL-1H1; IL-1RP2; IL1E; Il1f9; IL1F9_HUMAN; IL1H1; IL1RP2; IL36G; Interleukin 1 epsilon; Interleukin 1 family member 9; Interleukin 1 homolog 1; Interleukin 1 related protein 2; Interleukin 36 gamma; Interleukin-1 epsilon; Interleukin-1 family member 9; Interleukin-1 homolog 1;
Immunogens
A synthesized peptide derived from human IL1F9, corresponding to a region within N-terminal amino acids.
Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin. Expressed in monocyte-derived dendritic cells and M1 macrophages.
- Q9NZH8 IL36G_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Research Backgrounds
Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation: activates mitogen-activated protein kinases and NF-kappa B in primary lung fibroblasts, and stimulates the expression of IL-8 and CXCL3 and Th17 chemokine CCL20 in lung fibroblasts. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus.
N-terminal truncation leads to a dramatic enhancement of its activity (>1000-fold).
Secreted.
Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin. Expressed in monocyte-derived dendritic cells and M1 macrophages.
Belongs to the IL-1 family.
References
Application: WB Species: Mouse Sample: lung tissue
Application: IHC Species: Mouse Sample: lung tissue
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.