Product: IL1F9 Antibody
Catalog: DF10113
Description: Rabbit polyclonal antibody to IL1F9
Application: WB IHC
Reactivity: Human, Mouse
Mol.Wt.: 19 kDa; 19kD(Calculated).
Uniprot: Q9NZH8
RRID: AB_2840693

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
IL1F9 Antibody detects endogenous levels of total IL1F9.
RRID:
AB_2840693
Cite Format: Affinity Biosciences Cat# DF10113, RRID:AB_2840693.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

IL 1 epsilon; IL 1 related protein 2; IL 1(EPSILON); IL 1F9; IL 1H1; IL 1RP2; IL-1 epsilon; IL-1-related protein 2; IL-1F9; IL-1H1; IL-1RP2; IL1E; Il1f9; IL1F9_HUMAN; IL1H1; IL1RP2; IL36G; Interleukin 1 epsilon; Interleukin 1 family member 9; Interleukin 1 homolog 1; Interleukin 1 related protein 2; Interleukin 36 gamma; Interleukin-1 epsilon; Interleukin-1 family member 9; Interleukin-1 homolog 1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q9NZH8 IL36G_HUMAN:

Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin. Expressed in monocyte-derived dendritic cells and M1 macrophages.

Sequence:
MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

PTMs - Q9NZH8 As Substrate

Site PTM Type Enzyme
T60 Phosphorylation
Y63 Phosphorylation

Research Backgrounds

Function:

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation: activates mitogen-activated protein kinases and NF-kappa B in primary lung fibroblasts, and stimulates the expression of IL-8 and CXCL3 and Th17 chemokine CCL20 in lung fibroblasts. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus.

PTMs:

N-terminal truncation leads to a dramatic enhancement of its activity (>1000-fold).

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin. Expressed in monocyte-derived dendritic cells and M1 macrophages.

Family&Domains:

Belongs to the IL-1 family.

References

1). Luteolin alleviated neutrophilic asthma by inhibiting IL-36γ secretion-mediated MAPK pathways. PHARMACEUTICAL BIOLOGY, 2023 (PubMed: 36604842) [IF=3.9]

Application: WB    Species: Mouse    Sample: lung tissue

Figure 2.Luteolin inhibits IL-36csecretion in a mouse model of severe asthma. (A) Immunohistochemistry (IHC) of IL-36cin mouse lung tissue. (B) Analysis of IL-36cIHC in mouse lung tissue. (C) IL-36cin mouse lung tissue as detected by western blotting. (D) Protein intensity analysis of IL-36cin mouse lung tissue as detected bywestern blotting.p

Application: IHC    Species: Mouse    Sample: lung tissue

Figure 2.Luteolin inhibits IL-36csecretion in a mouse model of severe asthma. (A) Immunohistochemistry (IHC) of IL-36cin mouse lung tissue. (B) Analysis of IL-36cIHC in mouse lung tissue. (C) IL-36cin mouse lung tissue as detected by western blotting. (D) Protein intensity analysis of IL-36cin mouse lung tissue as detected bywestern blotting.p

2). The mechanism on Prevotella melaninogenica promoting the inflammatory progression of oral lichen planus. CLINICAL AND EXPERIMENTAL IMMUNOLOGY, 2022 (PubMed: 35605143) [IF=3.4]

Application: WB    Species: Mouse    Sample:

Figure 3:P. melaninogenica induced the expression of IL-36γ in vitro and vivo. (a) The protein expression of IL-36γ following co-culture P. melaninogenica with NHOKs was detected by western blotting; (b) P. melaninogenica or PBS was inoculated into the buccal mucosa of the mice every other day. After 30 days, the buccal tissue was taken for immunohistochemical analysis; (c) representative immunohistochemical images of buccal mucosa of the mice using the anti-IL-36γ antibody and positive intensity of staining (magnification: 200×); (d) positive intensity of staining. Significance determined using Student’s t test.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.