Product: IFI6 Antibody
Catalog: DF10115
Description: Rabbit polyclonal antibody to IFI6
Application: WB
Cited expt.: WB
Reactivity: Human
Mol.Wt.: 13 kDa; 13kD(Calculated).
Uniprot: P09912
RRID: AB_2840695

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
IFI6 Antibody detects endogenous levels of total IFI6.
RRID:
AB_2840695
Cite Format: Affinity Biosciences Cat# DF10115, RRID:AB_2840695.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Ifi-6-16; IFI6; IFI6_HUMAN; Interferon alpha-inducible protein 6; Interferon-induced protein 6-16;

Immunogens

Immunogen:

A synthesized peptide derived from human IFI6, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Sequence:
MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE

Research Backgrounds

Function:

Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis. However, it has also been shown to have a pro-apoptotic activity. Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells.

PTMs:

Glycosylated.

Subcellular Location:

Mitochondrion inner membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the IFI6/IFI27 family.

References

1). Annexin A2 (ANXA2) regulates the transcription and alternative splicing of inflammatory genes in renal tubular epithelial cells. BMC genomics, 2022 (PubMed: 35906541) [IF=3.5]

Application: WB    Species: Human    Sample: HK2 cells

Fig. 2ANXA2 regulated inflammatory gene mRNA and protein expression in HK2 cells. A Top ten GO biological processes terms enriched by upregulated DEGs in shANXA2 cells vs shCtrl cells. B Top ten KEGG functional pathways enriched by upregulated DEGs in shANXA2 cells vs shCtrl cells. C Top ten KEGG functional pathways enriched by downregulated DEGs in shANXA2 cells vs shCtrl cells. D Validation of mRNA expression of CCL5, IFI6, IFI44, IFITM1,and LTB by qRT-PCR assay. E Validation of mRNA expression of IRF7 and ISG15 by qRT-PCR assay. F Representative images showing protein levels of ANXA2, CCL5, IFI6, IFI44, IFITM1, LTB, IRF7 and ISG15 in LV-shANXA2 group vs LV-shCtrl group. Results are represented as mean ± SD.(n = 3,* P 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.