KRT84 Antibody - #DF10116
Product: | KRT84 Antibody |
Catalog: | DF10116 |
Description: | Rabbit polyclonal antibody to KRT84 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 65 kDa; 65kD(Calculated). |
Uniprot: | Q9NSB2 |
RRID: | AB_2840696 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10116, RRID:AB_2840696.
Fold/Unfold
hard keratin, type II, 4; HB4; K84; keratin 84; Keratin; keratin, hair, basic, 4; keratin, type II cuticular Hb4; Keratin-84; KRT84; KRT84_HUMAN; KRTHB4; type II cuticular Hb4; type II hair keratin 4; Type II hair keratin Hb4; type II keratin Kb24; Type-II keratin Kb24;
Immunogens
- Q9NSB2 KRT84_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSCRSYRVSSGHRVGNFSSCSAMTPQNLNRFRANSVSCWSGPGFRGLGSFGSRSVITFGSYSPRIAAVGSRPIHCGVRFGAGCGMGFGDGRGVGLGPRADSCVGLGFGAGSGIGYGFGGPGFGYRVGGVGVPAAPSITAVTVNKSLLTPLNLEIDPNAQRVKKDEKEQIKTLNNKFASFIDKVRFLEQQNKLLETKWSFLQEQKCIRSNLEPLFESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAENEFVALKKDVDAAFMNKSDLEANVDTLTQEIDFLKTLYMEEIQLLQSHISETSVIVKMDNSRDLNLDGIIAEVKAQYEEVARRSRADAEAWYQTKYEEMQVTAGQHCDNLRNIRNEINELTRLIQRLKAEIEHAKAQRAKLEAAVAEAEQQGEATLSDAKCKLADLECALQQAKQDMARQLCEYQELMNAKLGLDIEIATYRRLLEGEESRLCEGVGPVNISVSSSRGGLVCGPEPLVAGSTLSRGGVTFSGSSSVCATSGVLASCGPSLGGARVAPATGDLLSTGTRSGSMLISEACVPSVPCPLPTQGGFSSCSGGRSSSVRFVSTTTSCRTKY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NSB2 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Phosphorylation | Uniprot | |
K163 | Ubiquitination | Uniprot | |
K166 | Ubiquitination | Uniprot | |
K170 | Ubiquitination | Uniprot | |
T171 | Phosphorylation | Uniprot | |
K175 | Acetylation | Uniprot | |
K175 | Methylation | Uniprot | |
K175 | Sumoylation | Uniprot | |
K175 | Ubiquitination | Uniprot | |
S178 | Phosphorylation | Uniprot | |
K182 | Acetylation | Uniprot | |
K182 | Ubiquitination | Uniprot | |
K191 | Ubiquitination | Uniprot | |
Y341 | Phosphorylation | Uniprot | |
Y360 | Phosphorylation | Uniprot | |
K438 | Sumoylation | Uniprot | |
K455 | Methylation | Uniprot | |
S474 | Phosphorylation | Uniprot |
Research Backgrounds
Expressed in the hair follicles.
Heterotetramer of two type I and two type II keratins.
Belongs to the intermediate filament family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.