KLF17 Antibody - #DF10124
Product: | KLF17 Antibody |
Catalog: | DF10124 |
Description: | Rabbit polyclonal antibody to KLF17 |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 43 kDa; 43kD(Calculated). |
Uniprot: | Q5JT82 |
RRID: | AB_2840704 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10124, RRID:AB_2840704.
Fold/Unfold
FLJ40160; KLF17; KLF17_HUMAN; Krueppel like factor 17; Krueppel-like factor 17; Novel zinc finger protein; RP4 675G8.1; RP4675G8.1; Zfp393; Zinc finger protein 393; ZNF393;
Immunogens
A synthesized peptide derived from human KLF17, corresponding to a region within C-terminal amino acids.
- Q5JT82 KLF17_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPSIQHFPHSAEMLGSPLVSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPPQQEMTIFSGPQLMPVGEPNIPRVARPFGGNLRMPPNGLPVSASTGIPIMSHTGNPPVPYPGLSTVPSDETLLGPTVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTGRRGSSEARPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQCSREFMRSDHLKQHQKTHRPGPSDPQANNNNGEQDSPPAAGP
Research Backgrounds
Transcription repressor that binds to the promoter of target genes and prevents their expression. Acts as a negative regulator of epithelial-mesenchymal transition and metastasis in breast cancer. Specifically binds the 5'-CACCC-3' sequence in the promoter of ID1, a key metastasis regulator in breast cancer, and repress its expression. May be a germ cell-specific transcription factor that plays important roles in spermatid differentiation and oocyte development (By similarity).
Nucleus.
Belongs to the Sp1 C2H2-type zinc-finger protein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.