TSSK6 Antibody - #DF10142
| Product: | TSSK6 Antibody |
| Catalog: | DF10142 |
| Description: | Rabbit polyclonal antibody to TSSK6 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 30 kDa; 30kD(Calculated). |
| Uniprot: | Q9BXA6 |
| RRID: | AB_2840722 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10142, RRID:AB_2840722.
Fold/Unfold
Cancer/testis antigen 72; CT72; EC 2.7.11.1; FKSG82; FLJ24002; RGD1559764; Serine/threonine-protein kinase SSTK; Small serine/threonine kinase; Small serine/threonine protein kinase; SSTK; testis-specific serine kinase 6; Testis-specific serine/threonine kinase 6; Testis-specific serine/threonine-protein kinase 6; TSK 6; TSSK4; TSSK6;
Immunogens
A synthesized peptide derived from human TSSK6, corresponding to a region within the internal amino acids.
Highly expressed in testis. Expressed at lower levels in colon, small intestine, ovary, prostate, thymus, spleen and peripheral blood leukocytes.
- Q9BXA6 TSSK6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Required for sperm production and function. Plays a role in DNA condensation during postmeiotic chromatin remodeling (By similarity).
Autophosphorylated.
Ubiquitinated; HSP90 activity negatively regulates ubiquitination and degradation.
Highly expressed in testis. Expressed at lower levels in colon, small intestine, ovary, prostate, thymus, spleen and peripheral blood leukocytes.
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.