CEACAM8 Antibody - #DF10151
| Product: | CEACAM8 Antibody |
| Catalog: | DF10151 |
| Description: | Rabbit polyclonal antibody to CEACAM8 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | IHC, IF/ICC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 38 kDa; 38kD(Calculated). |
| Uniprot: | P31997 |
| RRID: | AB_2840730 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10151, RRID:AB_2840730.
Fold/Unfold
Carcinoembryonic antigen CGM6; Carcinoembryonic antigen gene family member 6; Carcinoembryonic antigen related cell adhesion molecule 8; Carcinoembryonic antigen-related cell adhesion molecule 8; CD 66b; CD 67; CD66b; CD66b antigen; CD67; CD67 antigen; CEACAM 8; CEACAM8; CEAM8_HUMAN; CGM 6; CGM6; NCA 95; NCA95; Non-specific cross-reacting antigen NCA-95; Nonspecific cross reacting antigen NCA 95; Nonspecific cross reacting antigen NCA95;
Immunogens
A synthesized peptide derived from human CEACAM8, corresponding to a region within N-terminal amino acids.
- P31997 CEAM8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
Research Backgrounds
Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils.
Glycosylated.
Cell membrane>Lipid-anchor. Cell surface.
Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
The N-terminus Ig-like V-type domain is necessary for heterophilic intercellular adhesion.
Belongs to the immunoglobulin superfamily. CEA family.
References
Application: IHC Species: human Sample:
Application: IHC Species: human Sample:
Application: IF/ICC Species: Human Sample: glioma tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.