Product: CEACAM8 Antibody
Catalog: DF10151
Description: Rabbit polyclonal antibody to CEACAM8
Application: WB IHC IF/ICC
Cited expt.: IHC, IF/ICC
Reactivity: Human, Rat
Mol.Wt.: 38 kDa; 38kD(Calculated).
Uniprot: P31997
RRID: AB_2840730

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
CEACAM8 Antibody detects endogenous levels of total CEACAM8.
RRID:
AB_2840730
Cite Format: Affinity Biosciences Cat# DF10151, RRID:AB_2840730.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Carcinoembryonic antigen CGM6; Carcinoembryonic antigen gene family member 6; Carcinoembryonic antigen related cell adhesion molecule 8; Carcinoembryonic antigen-related cell adhesion molecule 8; CD 66b; CD 67; CD66b; CD66b antigen; CD67; CD67 antigen; CEACAM 8; CEACAM8; CEAM8_HUMAN; CGM 6; CGM6; NCA 95; NCA95; Non-specific cross-reacting antigen NCA-95; Nonspecific cross reacting antigen NCA 95; Nonspecific cross reacting antigen NCA95;

Immunogens

Immunogen:

A synthesized peptide derived from human CEACAM8, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P31997 CEAM8_HUMAN:

Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.

Sequence:
MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI

Research Backgrounds

Function:

Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils.

PTMs:

Glycosylated.

Subcellular Location:

Cell membrane>Lipid-anchor. Cell surface.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.

Family&Domains:

The N-terminus Ig-like V-type domain is necessary for heterophilic intercellular adhesion.

Belongs to the immunoglobulin superfamily. CEA family.

References

1). Turning attention to tumor-host interface and focus on the peritumoral heterogeneity of glioblastoma. Nature communications, 2024 (PubMed: 39738017) [IF=16.6]

2). Neutrophil extracellular traps promote macrophage inflammation in psoriasis. Clinical immunology (Orlando, Fla.), 2024 (PubMed: 39002794) [IF=8.6]

3). Fc Fragment of IgE Receptor Ig (FCER1G) acts as a key gene involved in cancer immune infiltration and tumour microenvironment. Immunology, 2023 (PubMed: 36054819) [IF=4.9]

Application: IHC    Species: human    Sample:

FIGURE 7 FCER1G-associated partners enrichment analyses. (a) The protein–protein interaction network of 18 experimentally determined FCER1G-binding proteins. (b) Venn diagrams of the FCER1G-binding proteins and 50 FCER1G-related genes obtained from GEPIA2. The KEGG pathway analysis (c) and GO analysis (d) based on the combination of FCER1G-binding proteins and correlated genes (all p 

4). Tumor necrosis factor-α-inducible protein 8-like protein 3 (TIPE3): a novel prognostic factor in colorectal cancer. BMC cancer, 2023 (PubMed: 36755222) [IF=3.8]

Application: IHC    Species: human    Sample:

Fig. 3 Images of immunohistochemical staining immune cells in CRC tissue (200×): A, B Immunohistochemical staining of CD8+ T cells: A High expression; B Low expression; C, D Immunohistochemical staining of CD20+ B cells: C High expression; D Low expression; E, F Immunohistochemical staining of CD66b+ neutrophils: E High expression; F Low expression. Scale bar = 100 μm

5). TIPE2 combined with immune cell infiltration predicts prognosis in colorectal cancer. Scientific reports, 2025 (PubMed: 40745253) [IF=3.8]

6). Neutrophil extracellular traps induce a hypercoagulable state in glioma. Immunity Inflammation and Disease, 2021 (PubMed: 34288521) [IF=3.2]

Application: IF/ICC    Species: Human    Sample: glioma tissues

FIGURE 2 Platelet‐neutrophil interaction triggers NET generation in glioma patients. (A) Control neutrophils were incubated with PLT‐rich plasma from glioma patients and healthy subjects and stained with MPO (red) and DAPI (blue). (B) Plasma from stage III/IV glioma patients activated neutrophils to release higher proportions of NETs than those from stage I/II glioma patients and healthy subjects. (C) Immunofluorescence images also showed PLTs (CD41, green) decorated on DNA traps (DAPI, blue) when neutrophils (CD66b, red) were incubated with plasma from glioblastoma (GBM; stage IV glioma) patients. (D) PLT‐neutrophil aggregates, defined as CD41+/CD66b+ cells, were investigated in samples from each group. (E) The rate of PLT‐neutrophil aggregates was highest in samples from GBM patients. (F) Control neutrophils were incubated with PLTs from glioma patients and healthy subjects and analyzed by immunofluorescence microscopy. PLTs from stage III/IV glioma patients, especially GBM patients, were potent activators of NET formation than those from stage I/II glioma patients and healthy subjects. (G, H) Anti‐P‐selectin and PSGL‐1 antibodies were used to inhibit the interaction between neutrophils and PLTs and the NET (propidium iodide, red) formation was markedly decreased. The scale bar in (A) and (G) is 20 μm and (C) is 80μm. The results are expressed as the mean±SD. *p<.05, **p<.01, ***p<.001, and ****p<.0001. DAPI, 4′,6‐diamidino‐2‐ phenylindole; MPO, myeloperoxidase; NET, neutrophil extracellular trap; PLT, platelet

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.