ECM1 Antibody - #DF10163
| Product: | ECM1 Antibody |
| Catalog: | DF10163 |
| Description: | Rabbit polyclonal antibody to ECM1 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Pig, Horse |
| Mol.Wt.: | 61 kDa; 61kD(Calculated). |
| Uniprot: | Q16610 |
| RRID: | AB_2840742 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10163, RRID:AB_2840742.
Fold/Unfold
ECM 1; Ecm1; ECM1_HUMAN; Extracellular matrix protein 1; Secretory component p85; URBWD;
Immunogens
Expressed in breast cancer tissues. Little or no expression observed in normal breast tissues. Expressed in skin; wide expression is observed throughout the dermis with minimal expression in the epidermis.
- Q16610 ECM1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q16610 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T3 | Phosphorylation | Uniprot | |
| S18 | Phosphorylation | Uniprot | |
| Y43 | Phosphorylation | Uniprot | |
| S48 | O-Glycosylation | Uniprot | |
| S119 | O-Glycosylation | Uniprot | |
| T391 | O-Glycosylation | Uniprot | |
| T411 | Phosphorylation | Uniprot | |
| T418 | Phosphorylation | Uniprot | |
| T433 | Phosphorylation | Uniprot | |
| N444 | N-Glycosylation | Uniprot |
Research Backgrounds
Involved in endochondral bone formation as negative regulator of bone mineralization. Stimulates the proliferation of endothelial cells and promotes angiogenesis. Inhibits MMP9 proteolytic activity.
Secreted>Extracellular space>Extracellular matrix.
Expressed in breast cancer tissues. Little or no expression observed in normal breast tissues. Expressed in skin; wide expression is observed throughout the dermis with minimal expression in the epidermis.
Interacts (via C-terminus) with HSPG2 (via C-terminus). Interacts with EFEMP1/FBLN3 and LAMB3. Interacts with MMP9.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.