OPTC Antibody - #DF10169
| Product: | OPTC Antibody |
| Catalog: | DF10169 |
| Description: | Rabbit polyclonal antibody to OPTC |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 37 kDa; 37kD(Calculated). |
| Uniprot: | Q9UBM4 |
| RRID: | AB_2840748 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10169, RRID:AB_2840748.
Fold/Unfold
Oculoglycan; OPT; OPT_HUMAN; OPTC; Opticin;
Immunogens
A synthesized peptide derived from human OPTC, corresponding to a region within the internal amino acids.
Expressed in cartilage and synovial membranes (at protein level) (PubMed:18164633, PubMed:23845380). Expressed in the retina, iris, ligament, skin and fetal liver (at protein level) (PubMed:12019215, PubMed:25136834). Expressed in the retinal pigment epithelium (at protein level) (PubMed:25136834). Expressed in synovial fibroblasts and subchondral bone osteoblasts (PubMed:18164633).
- Q9UBM4 OPT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRLLAFLSLLALVLQETGTASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGLLLSSQPNHGLPTCLVCVCLGSSVYCDDIDLEDIPPLPRRTAYLYARFNRISRIRAEDFKGLTKLKRIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQPAAFRAMEKLQFLYLSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Inhibits angiogenesis in the vitreous humor of the eye, and therefore represses neovascularization (By similarity). Binds collagen fibrils (By similarity). May be involved in collagen fiber organization via regulation of other members of the small leucine-rich repeat proteoglycan superfamily (By similarity).
O-glycosylated.
Proteolytically cleaved by MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, ADAMTS4, and ADAMTS5. Proteolytically cleaved by MMP13 (By similarity). The degradation of OPTC by proteases may contribute to osteoarthritis pathophysiology.
Sulfated on tyrosine residues.
Secreted>Extracellular space>Extracellular matrix.
Expressed in cartilage and synovial membranes (at protein level). Expressed in the retina, iris, ligament, skin and fetal liver (at protein level). Expressed in the retinal pigment epithelium (at protein level). Expressed in synovial fibroblasts and subchondral bone osteoblasts.
Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class III subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.