Product: Glycophorin A Antibody
Catalog: DF10170
Description: Rabbit polyclonal antibody to Glycophorin A
Application: WB IHC IF/ICC
Reactivity: Human, Rat
Mol.Wt.: 16 kDa; 16kD(Calculated).
Uniprot: P02724
RRID: AB_2840749

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
Glycophorin A Antibody detects endogenous levels of total Glycophorin A.
RRID:
AB_2840749
Cite Format: Affinity Biosciences Cat# DF10170, RRID:AB_2840749.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AI853584; Blood group--MN locus; CD_antigen=CD235a; CD235a; GLPA_HUMAN; Glycophorin A (MNS blood group); Glycophorin A; Glycophorin A, included; Glycophorin-A; GlycophorinA; GPA; GPErik; GpMiIII; GPSAT; GYPA; GYPA, included; HGpMiIII; HGpMiV; HGpMiX; HGpMiXI; HGpSta(C); MN; MN sialoglycoprotein; MNS; PAS-2; PAS2; Sialoglycoprotein alpha;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ

PTMs - P02724 As Substrate

Site PTM Type Enzyme
S21 O-Glycosylation
T22 O-Glycosylation
T23 O-Glycosylation
T29 O-Glycosylation
S30 O-Glycosylation
T31 O-Glycosylation
S32 O-Glycosylation
T36 O-Glycosylation
S38 O-Glycosylation
S41 O-Glycosylation
T44 O-Glycosylation
N45 N-Glycosylation
T52 O-Glycosylation
T56 O-Glycosylation
S63 O-Glycosylation
S66 O-Glycosylation
T69 O-Glycosylation
S121 Phosphorylation
S130 Phosphorylation
T133 Phosphorylation
S138 Phosphorylation
S139 Phosphorylation
T147 Phosphorylation
S148 Phosphorylation

Research Backgrounds

Function:

Glycophorin A is the major intrinsic membrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte membrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma membrane. Is a receptor for influenza virus. Is a receptor for Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175); binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans. Appears to be a receptor for Hepatitis A virus (HAV).

PTMs:

The major O-linked glycan are NeuAc-alpha-(2-3)-Gal-beta-(1-3)-[NeuAc-alpha-(2-6)]-GalNAcOH (about 78 %) and NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH (17 %). Minor O-glycans (5 %) include NeuAc-alpha-(2-3)-Gal-beta-(1-3)-[NeuAc-alpha-(2-6)]-GalNAcOH NeuAc-alpha-(2-8)-NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH. About 1% of all O-linked glycans carry blood group A, B and H determinants. They derive from a type-2 precursor core structure, Gal-beta-(1,3)-GlcNAc-beta-1-R, and the antigens are synthesized by addition of fucose (H antigen-specific) and then N-acetylgalactosamine (A antigen-specific) or galactose (B antigen-specific). Specifically O-linked-glycans are NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH-(6-1)-GlcNAc-beta-(4-1)-[Fuc-alpha-(1-2)]-Gal-beta-(3-1)-GalNAc-alpha (about 1%, B antigen-specific) and NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH-(6-1)-GlcNAc-beta-(4-1)-[Fuc-alpha-(1-2)]-Gal-beta (1 %, O antigen-, A antigen- and B antigen-specific).

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.
Note: Appears to be colocalized with SLC4A1.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer.

(Microbial infection) Interacts with Streptococcus gordonii hsa protein.

Family&Domains:

Belongs to the glycophorin A family.

Research Fields

· Human Diseases > Infectious diseases: Parasitic > Malaria.

· Organismal Systems > Immune system > Hematopoietic cell lineage.   (View pathway)

References

1). Bioinspired Nanosponge for Salvaging Ischemic Stroke via Free Radical Scavenging and Self-Adapted Oxygen Regulating. NANO LETTERS (PubMed: 31830790) [IF=10.8]

Application: WB    Species: mouse    Sample: erythrocyte

Figure S3. Component analysis of Hb, Mn, total protein in MNET. (A) Hb concentrtion of erythrocyte, NET and MNET (n=3). (B) ICP-MS analysis of Mn amounts in NE and MNE (n=3). (C) The analysis of SDS-PAGE protein electrophoresis of Marker , erythrocyte , NET and MNET. (D) Western blot analysis of Hb, CD41, CD235a and CD47 protein expression in different preparations.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.