CLEC6A Antibody - #DF10182
| Product: | CLEC6A Antibody |
| Catalog: | DF10182 |
| Description: | Rabbit polyclonal antibody to CLEC6A |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 24 kDa; 24kD(Calculated). |
| Uniprot: | Q6EIG7 |
| RRID: | AB_2840761 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10182, RRID:AB_2840761.
Fold/Unfold
C type lectin domain family 6 member A; C type lectin superfamily member 10; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 10; C-type lectin domain family 6 member A; C-type lectin superfamily member 10; CLC6A_HUMAN; CLEC4N; CLEC4N, mouse, homolog of; Clec6a; CLECSF10; DC associated C type lectin 2; DC-associated C-type lectin 2; Dectin-2; Dectin2; Dendritic cell associated lectin 2; Dendritic cell-associated C-type lectin 2;
Immunogens
Expressed in lung, spleen, lymph node, leukocytes, bone marrow, tonsils and dendritic cells. Strongly expressed in purified monocytes and weakly in B-cells. In peripheral blood cells, preferentially expressed in plasmacytoids rather than myeloids.
- Q6EIG7 CLC6A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL
PTMs - Q6EIG7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K12 | Ubiquitination | Uniprot |
Research Backgrounds
Binds high-mannose carbohydrates in a Ca(2+)-dependent manner. Functional receptor for alpha-mannans on C.albicans hypheas. Plays an important role in the host defense against C.albicans infection by inducing TH17 cell differentiation. Recognizes also, in a mannose-dependent manner, allergens from house dust mite and fungi, by promoting cysteinyl leukotriene production. Recognizes soluble elements from the eggs of Shistosoma mansoni altering adaptive immune responses. Transduces signals through an Fc receptor gamma chain /FCER1G and Syk-CARD9-NF-kappa-B-dependent pathway (By similarity).
Membrane>Single-pass type II membrane protein.
Expressed in lung, spleen, lymph node, leukocytes, bone marrow, tonsils and dendritic cells. Strongly expressed in purified monocytes and weakly in B-cells. In peripheral blood cells, preferentially expressed in plasmacytoids rather than myeloids.
Associated with FCER1G.
A short stretch of the intracellular domain (AA 8-14) proximal to the transmembrane domain is required for association with Fc receptor gamma chain.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.