REG4 Antibody - #DF10183
| Product: | REG4 Antibody |
| Catalog: | DF10183 |
| Description: | Rabbit polyclonal antibody to REG4 |
| Application: | WB |
| Reactivity: | Human |
| Mol.Wt.: | 18 kDa; 18kD(Calculated). |
| Uniprot: | Q9BYZ8 |
| RRID: | AB_2840762 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10183, RRID:AB_2840762.
Fold/Unfold
Gastrointestinal secretory protein; GISP; Reg IV; REG like protein; REG-4; REG-like protein; Reg4; REG4_HUMAN; Regenerating gene type IV; Regenerating islet derived family member 4; Regenerating islet derived protein 4 precursor; Regenerating islet-derived protein 4; Regenerating islet-derived protein IV; REGIV; RELP;
Immunogens
A synthesized peptide derived from human REG4, corresponding to a region within the internal amino acids.
Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colorectal tumors than in normal colon. Preferentially expressed in mucinous tumors and in some cases neuro-endocrine tumors. Expressed in mucus-secreting cells and enterocyte-like cells. In small intestine expressed at the basal perinuclear zone of goblet cells.
- Q9BYZ8 REG4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Research Backgrounds
Calcium-independent lectin displaying mannose-binding specificity and able to maintain carbohydrate recognition activity in an acidic environment. May be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium.
Secreted.
Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colorectal tumors than in normal colon. Preferentially expressed in mucinous tumors and in some cases neuro-endocrine tumors. Expressed in mucus-secreting cells and enterocyte-like cells. In small intestine expressed at the basal perinuclear zone of goblet cells.
Research Fields
· Human Diseases > Cancers: Specific types > Gastric cancer. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.