MFGE8 Antibody - #DF10184
| Product: | MFGE8 Antibody |
| Catalog: | DF10184 |
| Description: | Rabbit polyclonal antibody to MFGE8 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Xenopus |
| Mol.Wt.: | 43 kDa; 43kD(Calculated). |
| Uniprot: | Q08431 |
| RRID: | AB_2840763 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10184, RRID:AB_2840763.
Fold/Unfold
BA46; Breast epithelial antigen BA46; EDIL1; HMFG; hP47; HsT19888; Lactadherin; Medin; MFG-E8; MFGE8; MFGM; MFGM_HUMAN; Milk fat globule EGF factor 8; Milk fat globule EGF factor 8 protein; Milk fat globule-EGF factor 8; O acetyl disialoganglioside synthase; OAcGD3S; SED1; SPAG10; Sperm associated antigen 10; Sperm surface protein hP47;
Immunogens
A synthesized peptide derived from human MFGE8, corresponding to a region within C-terminal amino acids.
Mammary epithelial cell surfaces and aortic media. Overexpressed in several carcinomas.
- Q08431 MFGM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization (By similarity). Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction.
Medin is the main constituent of aortic medial amyloid.
Medin has a ragged N-terminus with minor species starting at Pro-264 and Gly-273.
Membrane>Peripheral membrane protein. Secreted.
Mammary epithelial cell surfaces and aortic media. Overexpressed in several carcinomas.
The F5/8 type C 2 domain mediates high-affinity binding to phosphatidylserine-containing membranes.
References
Application: WB Species: Human Sample: HVSMCs
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.