PLUNC Antibody - #DF10185
| Product: | PLUNC Antibody |
| Catalog: | DF10185 |
| Description: | Rabbit polyclonal antibody to PLUNC |
| Application: | WB IHC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 27 kDa; 27kD(Calculated). |
| Uniprot: | Q9NP55 |
| RRID: | AB_2840764 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10185, RRID:AB_2840764.
Fold/Unfold
BPIFA1; bA49G10.5; LPLUNC3; Lung-specific protein X; LUNX; NASG; Nasopharyngeal carcinoma-related protein; Palate lung and nasal epithelium clone protein; PLUNC; Protein Plunc; Secretory protein in upper respiratory tracts; SPLUNC1; SPURT; Tracheal epithelium-enriched protein; Von Ebner protein Hl;
Immunogens
A synthesized peptide derived from human PLUNC, corresponding to a region within the internal amino acids.
Highly expressed in lung, upper airways and nasopharyngeal regions, including trachea and nasal epithelium (at protein level) (PubMed:11018263, PubMed:11251963, PubMed:12409287, PubMed:11425234, PubMed:26559477). Specifically expressed in the secretory ducts and submucosal glands of tracheobronchial tissues (at protein level) (PubMed:12409287, PubMed:11425234). Also expressed in the eye where it is detected in lacrimal gland, eyelid, conjunctiva and cornea (at protein level) (PubMed:26559477). Specifically localizes to epithelial cell layers in cornea, eyelid (basal epithelium) and conjunctiva (at protein level) (PubMed:26559477). Detected within acinar cells and ducts in the lacrimal and Meibomian glands (at protein level) (PubMed:26559477). In lung, shows highest expression in the trachea and progressive decrease from proximal (bronchial) to distal (bronchiolar) airways (PubMed:12409287). Also expressed in lung cancers and some other types of cancer (PubMed:11251963).
- Q9NP55 BPIA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
Research Backgrounds
Lipid-binding protein which shows high specificity for the surfactant phospholipid dipalmitoylphosphatidylcholine (DPPC). Plays a role in the innate immune responses of the upper airways. Reduces the surface tension in secretions from airway epithelia and inhibits the formation of biofilm by pathogenic Gram-negative bacteria, such as P.aeruginosa and K.pneumoniae. Negatively regulates proteolytic cleavage of SCNN1G, an event that is required for activation of the epithelial sodium channel (ENaC), and thereby contributes to airway surface liquid homeostasis and proper clearance of mucus. Plays a role in the airway inflammatory response after exposure to irritants. May attract macrophages and neutrophils.
May be N-glycosylated.
Secreted.
Note: Apical side of airway epithelial cells. Detected in airway surface liquid, nasal mucus and sputum.
Highly expressed in lung, upper airways and nasopharyngeal regions, including trachea and nasal epithelium (at protein level). Specifically expressed in the secretory ducts and submucosal glands of tracheobronchial tissues (at protein level). Also expressed in the eye where it is detected in lacrimal gland, eyelid, conjunctiva and cornea (at protein level). Specifically localizes to epithelial cell layers in cornea, eyelid (basal epithelium) and conjunctiva (at protein level). Detected within acinar cells and ducts in the lacrimal and Meibomian glands (at protein level). In lung, shows highest expression in the trachea and progressive decrease from proximal (bronchial) to distal (bronchiolar) airways. Also expressed in lung cancers and some other types of cancer.
Belongs to the BPI/LBP/Plunc superfamily. Plunc family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.