FDCSP Antibody - #DF10187
| Product: | FDCSP Antibody |
| Catalog: | DF10187 |
| Description: | Rabbit polyclonal antibody to FDCSP |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 10 kDa; 10kD(Calculated). |
| Uniprot: | Q8NFU4 |
| RRID: | AB_2840766 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10187, RRID:AB_2840766.
Fold/Unfold
C4orf7; FDC secreted protein; FDC-SP; FDCSP; FDSCP_HUMAN; Follicular dendritic cell secreted peptide; Follicular dendritic cell secreted protein;
Immunogens
A synthesized peptide derived from human FDCSP, corresponding to a region within the internal amino acids.
Abundantly expressed in tonsil, lymph node, and trachea; strong expression in prostate; lower expression in thyroid, stomach, and colon.
- Q8NFU4 FDSCP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK
Research Backgrounds
Can bind to the surface of B-lymphoma cells, but not T-lymphoma cells, consistent with a function as a secreted mediator acting upon B-cells.
O-glycosylated with core 1 or possibly core 8 glycans.
Secreted.
Abundantly expressed in tonsil, lymph node, and trachea; strong expression in prostate; lower expression in thyroid, stomach, and colon.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.