GPR182 Antibody - #DF10215
Product: | GPR182 Antibody |
Catalog: | DF10215 |
Description: | Rabbit polyclonal antibody to GPR182 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 45 kDa; 45kD(Calculated). |
Uniprot: | O15218 |
RRID: | AB_2840793 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10215, RRID:AB_2840793.
Fold/Unfold
7TMR; ADMR; Adrenomedullin L1 receptor; Adrenomedullin receptor; AM R; AM-R; AMR; G protein coupled receptor 182; g protein-coupled receptor g10d; G-protein coupled receptor 182; G10D; Gamrh; GP182_HUMAN; GPR 182; GPR182; hAMR; hrhAMR; MGC34399; rAMR;
Immunogens
A synthesized peptide derived from human GPR182, corresponding to a region within C-terminal amino acids.
Highly expressed in heart, skeletal muscle, immune system, adrenal gland and liver.
- O15218 GP182_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Research Backgrounds
Orphan receptor.
Cell membrane>Multi-pass membrane protein.
Highly expressed in heart, skeletal muscle, immune system, adrenal gland and liver.
Belongs to the G-protein coupled receptor 1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.