| Product: | Cofilin Antibody |
| Catalog: | AF0761 |
| Description: | Rabbit polyclonal antibody to Cofilin |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 19kDa(Observed); 19kD(Calculated). |
| Uniprot: | Q9Y281 | P23528 |
| RRID: | AB_2834371 |
Control Products
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0761, RRID:AB_2834371.
Fold/Unfold
CFL 2; CFL2; COF2_HUMAN; Cofilin 2 muscle; Cofilin; Cofilin muscle; Cofilin muscle isoform; Cofilin-2; Cofilin2; muscle isoform; NEM 7; NEM7; 18 kDa phosphoprotein; CFL 1; CFL; CFL1; COF1_HUMAN; Cofilin 1; Cofilin 1 non muscle; Cofilin; Cofilin non muscle isoform; Cofilin-1; epididymis secretory protein Li 15; HEL-S-15; non-muscle isoform; p18;
Immunogens
A synthesized peptide derived from human Cofilin, corresponding to a region within the internal amino acids.
Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
P23528 COF1_HUMAN:Widely distributed in various tissues.
- Q9Y281 COF2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
- P23528 COF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere (By similarity).
The phosphorylation of Ser-24 may prevent recognition of the nuclear localization signal.
Nucleus matrix. Cytoplasm>Cytoskeleton.
Note: Colocalizes with CSPR3 in the Z line of sarcomeres.
Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
Belongs to the actin-binding proteins ADF family.
Binds to F-actin and exhibits pH-sensitive F-actin depolymerizing activity. Regulates actin cytoskeleton dynamics. Important for normal progress through mitosis and normal cytokinesis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required for the up-regulation of atypical chemokine receptor ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. Required for neural tube morphogenesis and neural crest cell migration (By similarity).
Inactivated by phosphorylation on Ser-3. Phosphorylated on Ser-3 in resting cells (By similarity). Dephosphorylated by PDXP/chronophin; this restores its activity in promoting actin filament depolymerization. The phosphorylation of Ser-24 may prevent recognition of the nuclear localization signal (By similarity). Phosphorylated via a ARRB1-RAC1-LIMK1-PAK1 cascade upon active ligand stimulation of atypical chemokine receptor ACKR2.
Nucleus matrix. Cytoplasm>Cytoskeleton. Cell projection>Ruffle membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Lamellipodium membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Lamellipodium.
Note: Colocalizes with the actin cytoskeleton in membrane ruffles and lamellipodia. Detected at the cleavage furrow and contractile ring during cytokinesis. Almost completely in nucleus in cells exposed to heat shock or 10% dimethyl sulfoxide.
Widely distributed in various tissues.
Belongs to the actin-binding proteins ADF family.
Research Fields
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Organismal Systems > Development > Axon guidance. (View pathway)
· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis. (View pathway)
References
Application: WB Species: Human Sample: breast tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.