DNAJC15 Antibody - #DF2918
| Product: | DNAJC15 Antibody |
| Catalog: | DF2918 |
| Description: | Rabbit polyclonal antibody to DNAJC15 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 16kDa; 16kD(Calculated). |
| Uniprot: | Q9Y5T4 |
| RRID: | AB_2840906 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2918, RRID:AB_2840906.
Fold/Unfold
Cell growth inhibiting gene 22 protein; Cell growth-inhibiting gene 22 protein; DJC15_HUMAN; DnaJ (Hsp40) homolog subfamily C member 15; DNAJ domain containing; DnaJ homolog subfamily C member 15; DNAJC15; DNAJD1; GIG22; HSD18; MCJ; Methylation controlled J protein; Methylation-controlled J protein;
Immunogens
A synthesized peptide derived from human DNAJC15, corresponding to a region within the internal amino acids.
- Q9Y5T4 DJC15_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP (By similarity). Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9.
Mitochondrion inner membrane>Single-pass membrane protein.
Expressed at highest levels in heart, followed by liver and kidney.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.