COX19 Antibody - #AF0578
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0578, RRID:AB_2834375.
Fold/Unfold
COX19 cytochrome c oxidase assembly homolog (S. cerevisiae); hCOX19;
Immunogens
- Q49B96 COX19_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQEPLEKLGFGDLTSGKSEAKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q49B96 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Acetylation | Uniprot | |
| S55 | Phosphorylation | Uniprot | |
| Y58 | Phosphorylation | Uniprot | |
| K85 | Ubiquitination | Uniprot |
Research Backgrounds
Required for the transduction of an SCO1-dependent redox signal from the mitochondrion to ATP7A to regulate cellular copper homeostasis. May be required for the assembly of mitochondrial cytochrome c oxidase (By similarity).
Cytoplasm>Cytosol. Mitochondrion intermembrane space. Mitochondrion.
Note: Partitions between mitochondria and the cytosol in a copper-dependent manner. Enriched in the cytosol when intracellular copper concentrations are elevated.
Ubiquitously expressed. Highly expressed in skeletal muscle.
Interacts with CHCHD4/MIA40 forming transient intermolecular disulfide bridges.
Belongs to the COX19 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.