UCHL3 Antibody - #DF2964
| Product: | UCHL3 Antibody |
| Catalog: | DF2964 |
| Description: | Rabbit polyclonal antibody to UCHL3 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Chicken |
| Mol.Wt.: | 26kDa; 26kD(Calculated). |
| Uniprot: | P15374 |
| RRID: | AB_2840946 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2964, RRID:AB_2840946.
Fold/Unfold
Ubiquitin carboxyl-terminal hydrolase isozyme L3; Ubiquitin thioesterase L3; Ubiquitin thiolesterase; Ubiquitin thiolesterase L3; UCH L3; UCH-L3; UCHL3; UCHL3_HUMAN;
Immunogens
- P15374 UCHL3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P15374 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S43 | Phosphorylation | Uniprot | |
| K61 | Ubiquitination | Uniprot | |
| S75 | Phosphorylation | Uniprot | |
| T81 | Phosphorylation | Uniprot | |
| S82 | Phosphorylation | Uniprot | |
| Y85 | Phosphorylation | Uniprot | |
| T97 | Phosphorylation | Uniprot | |
| K110 | Ubiquitination | Uniprot | |
| K121 | Ubiquitination | Uniprot | |
| S128 | Phosphorylation | Uniprot | |
| S130 | Phosphorylation | Uniprot | |
| Y141 | Phosphorylation | Uniprot | |
| S151 | Phosphorylation | Uniprot | |
| S161 | Phosphorylation | Uniprot | |
| K165 | Ubiquitination | Uniprot | |
| K210 | Ubiquitination | Uniprot | |
| K211 | Ubiquitination | Uniprot |
Research Backgrounds
Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3'', and exhibits a preference towards 'Lys-48'-linked ubiquitin chains. Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory. Can hydrolyze UBB(+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome and is associated with neurogenerative disorders.
Cytoplasm.
Highly expressed in heart, skeletal muscle, and testis.
Preferentially binds diubiquitin; the interaction does not hydrolyze diubiquitin but, in vitro, inhibits the hydrolyzing activity on other substrates.
Belongs to the peptidase C12 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.