RNF144A Antibody - #AF0657
| Product: | RNF144A Antibody |
| Catalog: | AF0657 |
| Description: | Rabbit polyclonal antibody to RNF144A |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken |
| Mol.Wt.: | 30kDa; 33kD(Calculated). |
| Uniprot: | P50876 |
| RRID: | AB_2834385 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0657, RRID:AB_2834385.
Fold/Unfold
KIAA0161; Probable E3 ubiquitin protein ligase RNF144A; Probable E3 ubiquitin-protein ligase RNF144A; R144A_HUMAN; Ring finger protein 144; RING finger protein 144A; RNF 144; RNF 144A; rnf144a; UBCE7IP4; UbcM4 interacting protein 4; UbcM4-interacting protein 4; Ubiquitin conjugating enzyme 7 interacting protein 4; Ubiquitin-conjugating enzyme 7-interacting protein 4;
Immunogens
- P50876 R144A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTTTRYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P50876 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K183 | Ubiquitination | Uniprot | |
| K187 | Sumoylation | Uniprot | |
| K189 | Sumoylation | Uniprot |
Research Backgrounds
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates the ubiquitination and degradation of the DNA damage kinase PRKDC.
Autoubiquitinated.
Cell membrane>Single-pass membrane protein. Cytoplasmic vesicle membrane.
Interacts with UBE2L3.
Members of the RBR family are atypical E3 ligases. They interact with the E2 conjugating enzyme UBE2L3 and function like HECT-type E3 enzymes: they bind E2s via the first RING domain, but require an obligate trans-thiolation step during the ubiquitin transfer, requiring a conserved cysteine residue in the second RING domain.
Belongs to the RBR family. RNF144 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.