AIF1/IBA1 Antibody - #DF7552

(1)   (3)  
Product: AIF1/IBA1 Antibody
Catalog: DF7552
Description: Rabbit polyclonal antibody to AIF1/IBA1
Application: WB IHC
Reactivity: Human, Rat
Mol.Wt.: 17 kDa; 17kD(Calculated).
Uniprot: P55008
RRID: AB_2841047

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
AIF1/IBA1 Antibody detects endogenous levels of total AIF1/IBA1.
RRID:
AB_2841047
Cite Format: Affinity Biosciences Cat# DF7552, RRID:AB_2841047.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AIF 1; AIF-1; Aif1; AIF1 protein; AIF1_HUMAN; Allograft inflammatory factor 1; Allograft inflammatory factor 1 splice variant G; allograft inflammatory factor-1 splice variant Hara-1; balloon angioplasty responsive transcription; BART 1; G1; G1 putative splice variant of allograft inflamatory factor 1; IBA 1; IBA1; interferon gamma responsive transcript; Interferon responsive transcript 1; interferon responsive transcript factor 1; Ionized calcium binding adapter molecule 1; Ionized calcium-binding adapter molecule 1; ionized calcium-binding adapter molecule; IRT 1; IRT1; Microglia response factor; MRF1; Protein g1;

Immunogens

Immunogen:
Uniprot:

P55008(AIF1_HUMAN) >>Visit HPA database.

Gene(ID):
AIF1(199)
Expression:
P55008 AIF1_HUMAN:

Detected in T-lymphocytes and peripheral blood mononuclear cells.

Sequence:
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

PTMs - P55008 As Substrate

Site PTM Type Enzyme
S2 Phosphorylation
K11 Acetylation
K11 Ubiquitination
Y37 Phosphorylation
S38 Phosphorylation
S39 Phosphorylation
Y54 Phosphorylation
S69 Phosphorylation
K76 Ubiquitination
K81 Ubiquitination
K113 Methylation
Y124 Phosphorylation

Research Backgrounds

Function:

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

PTMs:

Phosphorylated on serine residues.

Subcellular Location:

Cytoplasm>Cytoskeleton. Cell projection>Ruffle membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Phagocytic cup.
Note: Associated with the actin cytoskeleton at membrane ruffles and at sites of phagocytosis.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in T-lymphocytes and peripheral blood mononuclear cells.

Subunit Structure:

Homodimer (Potential). Monomer. Interacts with LCP1.

References

1). Effect of Shenqi Jieyu formula on inflammatory response pathway in hippocampus of postpartum depression rats. Heliyon, 2024 (PubMed: 38726147) [IF=4.0]

Application: IHC    Species: Rat    Sample:

Fig. 12 Protein expression of Ibal‾(χ±s, n = 3) in hippocampi of rats in each group (200 × ). Protein expression of Ibal increased in PPD animals. SJF, AUDA, and paroxetine hydrochloride reversed the changes in protein expression of Ibal.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.