PDI Antibody - #DF7593

Product: | PDI Antibody |
Catalog: | DF7593 |
Description: | Rabbit polyclonal antibody to PDI |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 61 kDa; 58kD(Calculated). |
Uniprot: | Q13087 |
RRID: | AB_2841084 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7593, RRID:AB_2841084.
Fold/Unfold
Pancreas-specific protein disulfide isomerase; pancreatic protein disulfide isomerase; PDIA2; PDIA2_HUMAN; PDIp; PDIR; protein disulfide isomerase family A member 2; protein disulfide isomerase, pancreatic; protein disulfide isomerase-associated 2; Protein disulfide-isomerase A2; Rho GDP dissociation inhibitor gamma;
Immunogens
A synthesized peptide derived from human PDI, corresponding to a region within C-terminal amino acids.
- Q13087 PDIA2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSRQLLPVLLLLLLRASCPWGQEQGARSPSEEPPEEEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGGVLPTEEPPEEPAAPFPEPPANSTMGSKEEL
Research Backgrounds
Acts as an intracellular estrogen-binding protein. May be involved in modulating cellular levels and biological functions of estrogens in the pancreas. May act as a chaperone that inhibits aggregation of misfolded proteins.
The disulfide-linked homodimer exhibits an enhanced chaperone activity.
Glycosylated.
Endoplasmic reticulum lumen.
Highly expressed in pancreas (at protein level).
Belongs to the protein disulfide isomerase family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.