Product: NCR1 Antibody
Catalog: DF7599
Description: Rabbit polyclonal antibody to NCR1
Application: WB IHC IF/ICC
Cited expt.: IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 35-50kD; 34kD(Calculated).
Uniprot: O76036
RRID: AB_2841090

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
NCR1 Antibody detects endogenous levels of total NCR1.
RRID:
AB_2841090
Cite Format: Affinity Biosciences Cat# DF7599, RRID:AB_2841090.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Activating NK receptor NK p46; CD335; FLJ99094; hNKp46; Ly94; Lymphocyte antigen 94; Lymphocyte antigen 94 homolog (activating NK receptor; NK p46); Lymphocyte antigen 94 homolog; Natural cytotoxicity triggering receptor 1; Natural killer cell p46-related protein; NCR1; NCT1; NCTR1_HUMAN; NK cell activating receptor; NK cell-activating receptor; NK-p46; NKp46;

Immunogens

Immunogen:

A synthesized peptide derived from human NCR1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
O76036 NCTR1_HUMAN:

Selectively expressed by both resting and activated NK cells.

Sequence:
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL

Research Backgrounds

Function:

Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.

PTMs:

N-glycosylated.

O-glycosylated.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Selectively expressed by both resting and activated NK cells.

Family&Domains:

Belongs to the natural cytotoxicity receptor (NCR) family.

Research Fields

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

References

1). Tumor cells impair immunological synapse formation via central nervous system-enriched metabolite. Cancer cell, 2024 (PubMed: 38821061) [IF=48.8]

2). pH-Triggered Copper-Free Click Reaction-Mediated Micelle Aggregation for Enhanced Tumor Retention and Elevated Immuno–Chemotherapy against Melanoma. ACS Applied Materials & Interfaces, 2021 (PubMed: 33834754) [IF=8.3]

Application: IF/ICC    Species: mice    Sample: NK cells

Figure 6. (A) Immunofluorescent CLSM images of B16F10 tumor slices at the end of treatment, NK cells were identified by the antimouse NKp46 antibody (red), and nuclei were visualized by DAPI (blue). Scale bar: 100 μm. (B) Flow cytometric analysis of intratumor NK cell populations identified by PE-conjugated antimouse NKp46. Error bars indicate SD (n = 3). ** and *** represent p < 0.01 and p < 0.001, respectively. (C) Typical immunohistochemical images of the B16F10 tumor sections stained with antibodies against IL-2 and GZMB. Scale bar: 100 μm. (D) Levels of IL-2, GZMB, and IFN-γ in tumor and (E) plasma analyzed by ELISA kits at the end of treatment. Error bars indicate SD (n = 3), *, **, and *** represent p < 0.05, p < 0.01, and p < 0.001, respectively. (F) Images of the expression level of intratumor phosphorylated Smad3 (pSmad3) and Smad3 by western blotting analysis, (a) PBS, (b) M-D@DOX, (c) free DOX/SIS3, (d) M-N@SIS3, (e) M@DOX/SIS3, and (f) MDN@DOX/SIS3. (G) Semiquantitative results of the expression levels of p-Smad3 and Smad3. Error bars indicate SD (n = 3), ** and *** represent p < 0.01 and p < 0.001, respectively.

3). がん免疫セラノスティクスのためのナノ操作細菌の開発. , 2023

Application: IHC    Species: Mouse    Sample: tumor tissues

Figure 3.32 IHC staining for IFN-γ, PD-1, CD8, CD4, and NKp46 in tumor tissues after i.t. injection of each sample with or without laser irradiation.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.