RHOQ Antibody - #DF7643
| Product: | RHOQ Antibody |
| Catalog: | DF7643 |
| Description: | Rabbit polyclonal antibody to RHOQ |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 25 kDa; 23kD(Calculated). |
| Uniprot: | P17081 |
| RRID: | AB_2841123 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7643, RRID:AB_2841123.
Fold/Unfold
ARHQ; Ras homolog gene family member Q; RAS like family 7 member A; Ras like protein family member 7A; Ras like protein TC10; Ras related GTP binding protein TC10; Ras-like protein family member 7A; Ras-like protein TC10; RASL7A; Rho related GTP binding protein RhoQ; Rho-related GTP-binding protein RhoQ; Rhoq; RHOQ_HUMAN; TC10A;
Immunogens
A synthesized peptide derived from human RHOQ, corresponding to a region within the internal amino acids.
- P17081 RHOQ_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. May play a role in CFTR trafficking to the plasma membrane. Causes the formation of thin, actin-rich surface projections called filopodia.
May be post-translationally modified by both palmitoylation and polyisoprenylation.
Cytoplasm. Cell membrane>Lipid-anchor.
Belongs to the small GTPase superfamily. Rho family.
Research Fields
· Organismal Systems > Endocrine system > Insulin signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.